Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 546498..547023 | Replicon | chromosome |
Accession | NZ_LR881936 | ||
Organism | Enterobacter cancerogenus strain UPC1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | ENTER_RS02645 | Protein ID | WP_141114080.1 |
Coordinates | 546730..547023 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D2ZLS4 |
Locus tag | ENTER_RS02640 | Protein ID | WP_006179065.1 |
Coordinates | 546498..546740 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ENTER_RS02625 | 542498..543238 | + | 741 | WP_202561584.1 | KDGP aldolase family protein | - |
ENTER_RS02630 | 543354..544490 | + | 1137 | WP_153681984.1 | lactonase family protein | - |
ENTER_RS02635 | 544510..546420 | + | 1911 | WP_088208736.1 | BglG family transcription antiterminator | - |
ENTER_RS02640 | 546498..546740 | + | 243 | WP_006179065.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
ENTER_RS02645 | 546730..547023 | + | 294 | WP_141114080.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ENTER_RS02650 | 547027..547491 | - | 465 | WP_202561585.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
ENTER_RS02655 | 547633..549771 | - | 2139 | WP_088208738.1 | anaerobic ribonucleoside-triphosphate reductase | - |
ENTER_RS02660 | 550139..550711 | - | 573 | WP_202561586.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11080.95 Da Isoelectric Point: 10.4241
>T289488 WP_141114080.1 NZ_LR881936:546730-547023 [Enterobacter cancerogenus]
MTYELEFDPRALKEGRKLGDTVKAQFKKKLASVLVNPRNESARLHDLHDLPDCYKIKLKSSGYRLVYQVRDAVVIVFVIS
IGKREKSAAYQAASKRL
MTYELEFDPRALKEGRKLGDTVKAQFKKKLASVLVNPRNESARLHDLHDLPDCYKIKLKSSGYRLVYQVRDAVVIVFVIS
IGKREKSAAYQAASKRL
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|