Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 238887..239413 | Replicon | plasmid pPSV |
| Accession | NZ_LR881935 | ||
| Organism | Citrobacter freundii strain PSV | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | CITRO_RS26590 | Protein ID | WP_000323025.1 |
| Coordinates | 238887..239174 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | CITRO_RS26595 | Protein ID | WP_000534858.1 |
| Coordinates | 239174..239413 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO_RS26535 | 234221..234604 | + | 384 | WP_050596975.1 | hypothetical protein | - |
| CITRO_RS26540 | 234615..234869 | + | 255 | WP_032610479.1 | hypothetical protein | - |
| CITRO_RS26545 | 234869..235285 | + | 417 | WP_032610480.1 | hypothetical protein | - |
| CITRO_RS26550 | 235403..235684 | + | 282 | WP_032610524.1 | hypothetical protein | - |
| CITRO_RS26555 | 235870..236424 | + | 555 | WP_015063016.1 | hypothetical protein | - |
| CITRO_RS26560 | 236484..236732 | + | 249 | WP_050596976.1 | hypothetical protein | - |
| CITRO_RS26565 | 236857..237189 | + | 333 | WP_032610481.1 | DUF5417 domain-containing protein | - |
| CITRO_RS26570 | 237234..237803 | + | 570 | WP_032610483.1 | hypothetical protein | - |
| CITRO_RS26575 | 237827..238177 | + | 351 | WP_032610485.1 | hypothetical protein | - |
| CITRO_RS26580 | 238217..238423 | + | 207 | WP_044255297.1 | hypothetical protein | - |
| CITRO_RS26585 | 238658..238816 | - | 159 | WP_064758473.1 | type I toxin-antitoxin system Hok family toxin | - |
| CITRO_RS26590 | 238887..239174 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| CITRO_RS26595 | 239174..239413 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| CITRO_RS26600 | 239676..240599 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| CITRO_RS26605 | 241071..242051 | + | 981 | WP_000019445.1 | IS5-like element ISKpn26 family transposase | - |
| CITRO_RS26610 | 242200..242571 | - | 372 | Protein_239 | cytochrome b/b6 domain-containing protein | - |
| CITRO_RS26615 | 243047..244285 | - | 1239 | WP_003030308.1 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..295415 | 295415 | |
| - | flank | IS/Tn | - | - | 241071..242051 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T289485 WP_000323025.1 NZ_LR881935:c239174-238887 [Citrobacter freundii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|