Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5051712..5052328 | Replicon | chromosome |
Accession | NZ_LR881934 | ||
Organism | Citrobacter freundii strain PSV |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | CITRO_RS24560 | Protein ID | WP_003028682.1 |
Coordinates | 5051712..5052086 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | CITRO_RS24565 | Protein ID | WP_043018956.1 |
Coordinates | 5052086..5052328 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CITRO_RS24545 | 5049215..5050117 | + | 903 | WP_016155183.1 | formate dehydrogenase O subunit beta | - |
CITRO_RS24550 | 5050114..5050749 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
CITRO_RS24555 | 5050746..5051675 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
CITRO_RS24560 | 5051712..5052086 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CITRO_RS24565 | 5052086..5052328 | - | 243 | WP_043018956.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
CITRO_RS24570 | 5052534..5053441 | + | 908 | Protein_4806 | alpha/beta hydrolase | - |
CITRO_RS24575 | 5053592..5054533 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
CITRO_RS24580 | 5054578..5055015 | - | 438 | WP_003028671.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
CITRO_RS24585 | 5055012..5055884 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
CITRO_RS24590 | 5055878..5056477 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T289483 WP_003028682.1 NZ_LR881934:c5052086-5051712 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |