Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4518680..4519386 | Replicon | chromosome |
Accession | NZ_LR881934 | ||
Organism | Citrobacter freundii strain PSV |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | CITRO_RS21970 | Protein ID | WP_202580809.1 |
Coordinates | 4518680..4519021 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | CITRO_RS21975 | Protein ID | WP_202581344.1 |
Coordinates | 4519057..4519386 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CITRO_RS21955 | 4514919..4516289 | - | 1371 | WP_003837154.1 | tyrosine phenol-lyase | - |
CITRO_RS21960 | 4517068..4517430 | + | 363 | WP_048219798.1 | endoribonuclease SymE | - |
CITRO_RS21965 | 4517583..4518455 | + | 873 | WP_081366016.1 | HNH endonuclease | - |
CITRO_RS21970 | 4518680..4519021 | - | 342 | WP_202580809.1 | TA system toxin CbtA family protein | Toxin |
CITRO_RS21975 | 4519057..4519386 | - | 330 | WP_202581344.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
CITRO_RS21980 | 4519428..4519649 | - | 222 | WP_202580810.1 | DUF987 domain-containing protein | - |
CITRO_RS21985 | 4519665..4520138 | - | 474 | WP_202580811.1 | DNA repair protein RadC | - |
CITRO_RS21990 | 4520208..4521026 | - | 819 | WP_202580812.1 | DUF945 domain-containing protein | - |
CITRO_RS21995 | 4521142..4521417 | - | 276 | WP_202580813.1 | DUF905 family protein | - |
CITRO_RS22000 | 4521414..4522085 | - | 672 | WP_202580814.1 | hypothetical protein | - |
CITRO_RS22005 | 4522685..4523449 | - | 765 | Protein_4314 | hypothetical protein | - |
CITRO_RS22010 | 4523811..4523978 | + | 168 | WP_199981140.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12823.74 Da Isoelectric Point: 6.7085
>T289482 WP_202580809.1 NZ_LR881934:c4519021-4518680 [Citrobacter freundii]
MNTLPVINQRAVQSCPSPVTIWQTLLTRLLEQHYGLALNDTPFGNESVIQEHIEAGITLVDAVNFLVEKYELARIDRRVF
SWLEPSPYLRAVDILRARRDTGLLRGCNHTVAP
MNTLPVINQRAVQSCPSPVTIWQTLLTRLLEQHYGLALNDTPFGNESVIQEHIEAGITLVDAVNFLVEKYELARIDRRVF
SWLEPSPYLRAVDILRARRDTGLLRGCNHTVAP
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|