Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3872053..3872673 Replicon chromosome
Accession NZ_LR881934
Organism Citrobacter freundii strain PSV

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag CITRO_RS19005 Protein ID WP_002892050.1
Coordinates 3872455..3872673 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID R8WZW8
Locus tag CITRO_RS19000 Protein ID WP_003021733.1
Coordinates 3872053..3872427 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CITRO_RS18990 3867199..3868392 + 1194 WP_003835922.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
CITRO_RS18995 3868415..3871564 + 3150 WP_202580717.1 multidrug efflux RND transporter permease subunit AcrB -
CITRO_RS19000 3872053..3872427 + 375 WP_003021733.1 Hha toxicity modulator TomB Antitoxin
CITRO_RS19005 3872455..3872673 + 219 WP_002892050.1 hemolysin expression modulator Hha Toxin
CITRO_RS19010 3872855..3873406 + 552 WP_138828274.1 maltose O-acetyltransferase -
CITRO_RS19015 3873523..3873993 + 471 WP_003021724.1 YlaC family protein -
CITRO_RS19020 3874071..3874211 - 141 WP_005125190.1 type B 50S ribosomal protein L36 -
CITRO_RS19025 3874213..3874473 - 261 WP_003021719.1 type B 50S ribosomal protein L31 -
CITRO_RS19030 3874662..3876215 + 1554 WP_003835927.1 EAL domain-containing protein -
CITRO_RS19035 3876267..3876620 - 354 WP_003831033.1 DUF1428 family protein -
CITRO_RS19040 3876685..3877314 - 630 WP_016149709.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T289481 WP_002892050.1 NZ_LR881934:3872455-3872673 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14427.23 Da        Isoelectric Point: 5.5653

>AT289481 WP_003021733.1 NZ_LR881934:3872053-3872427 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB R8WZW8

References