Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 1181850..1182583 | Replicon | chromosome |
| Accession | NZ_LR881934 | ||
| Organism | Citrobacter freundii strain PSV | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | CITRO_RS05725 | Protein ID | WP_133497682.1 |
| Coordinates | 1181850..1182179 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | CITRO_RS05730 | Protein ID | WP_167324548.1 |
| Coordinates | 1182218..1182583 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CITRO_RS05695 | 1176908..1177408 | - | 501 | WP_202581046.1 | hypothetical protein | - |
| CITRO_RS05700 | 1177544..1177813 | + | 270 | Protein_1113 | Polarity suppression protein | - |
| CITRO_RS05705 | 1178219..1178443 | + | 225 | WP_202581047.1 | DUF2188 domain-containing protein | - |
| CITRO_RS05710 | 1178498..1179088 | - | 591 | WP_202581048.1 | HNH endonuclease | - |
| CITRO_RS05715 | 1179081..1180256 | - | 1176 | WP_202581049.1 | AAA family ATPase | - |
| CITRO_RS05720 | 1180256..1181452 | - | 1197 | WP_202581050.1 | tyrosine-type recombinase/integrase | - |
| CITRO_RS05725 | 1181850..1182179 | - | 330 | WP_133497682.1 | TA system toxin CbtA family protein | Toxin |
| CITRO_RS05730 | 1182218..1182583 | - | 366 | WP_167324548.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| CITRO_RS05735 | 1182609..1182830 | - | 222 | WP_032680445.1 | DUF987 domain-containing protein | - |
| CITRO_RS05740 | 1182827..1183348 | - | 522 | WP_142468435.1 | DNA repair protein RadC | - |
| CITRO_RS05745 | 1183361..1183804 | - | 444 | WP_133497679.1 | antirestriction protein | - |
| CITRO_RS05750 | 1183835..1184656 | - | 822 | WP_133497678.1 | DUF945 domain-containing protein | - |
| CITRO_RS05755 | 1184755..1184985 | - | 231 | WP_133497677.1 | DUF905 domain-containing protein | - |
| CITRO_RS05760 | 1185057..1185506 | - | 450 | WP_167324547.1 | hypothetical protein | - |
| CITRO_RS05765 | 1185512..1185955 | - | 444 | WP_142468434.1 | hypothetical protein | - |
| CITRO_RS05770 | 1185992..1186561 | - | 570 | WP_142468469.1 | hypothetical protein | - |
| CITRO_RS05775 | 1186561..1187265 | - | 705 | WP_133497674.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12552.46 Da Isoelectric Point: 8.9299
>T289476 WP_133497682.1 NZ_LR881934:c1182179-1181850 [Citrobacter freundii]
MQKISSHPTRANQPCLSPIEIWQRLLTYLLSQHYGLTLNDTPFSNETIIHEHIDAGITLADVMNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
MQKISSHPTRANQPCLSPIEIWQRLLTYLLSQHYGLTLNDTPFSNETIIHEHIDAGITLADVMNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13416.17 Da Isoelectric Point: 5.4851
>AT289476 WP_167324548.1 NZ_LR881934:c1182583-1182218 [Citrobacter freundii]
MNNHSESGTKPECPACQLWGLKRAITPCFGARLVQEGNRVHFLADRAGFNGAFSDGDVLHLDQAFPLILKQLELMLTSGE
LNPRYQHCVSLYHNGLTCEADTLGSCGYVYISIYPEQTEPQ
MNNHSESGTKPECPACQLWGLKRAITPCFGARLVQEGNRVHFLADRAGFNGAFSDGDVLHLDQAFPLILKQLELMLTSGE
LNPRYQHCVSLYHNGLTCEADTLGSCGYVYISIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|