Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 971702..972308 | Replicon | chromosome |
| Accession | NZ_LR881183 | ||
| Organism | Thermococcus camini strain IRI35c | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | TIRI35C_RS05225 | Protein ID | WP_246454788.1 |
| Coordinates | 971913..972308 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | TIRI35C_RS05220 | Protein ID | WP_188202011.1 |
| Coordinates | 971702..971923 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| TIRI35C_RS05200 (TIRI35C_1035) | 967306..969594 | - | 2289 | WP_188202009.1 | alpha-amylase family glycosyl hydrolase | - |
| TIRI35C_RS05205 (TIRI35C_1036) | 969747..969977 | + | 231 | WP_014011940.1 | LSm family protein | - |
| TIRI35C_RS05210 (TIRI35C_1037) | 970003..970194 | + | 192 | WP_167902596.1 | 50S ribosomal protein L37e | - |
| TIRI35C_RS05215 (TIRI35C_1038) | 970284..971654 | + | 1371 | WP_188202010.1 | MATE family efflux transporter | - |
| TIRI35C_RS05220 (TIRI35C_1039) | 971702..971923 | + | 222 | WP_188202011.1 | hypothetical protein | Antitoxin |
| TIRI35C_RS05225 (TIRI35C_1040) | 971913..972308 | + | 396 | WP_246454788.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| TIRI35C_RS05230 (TIRI35C_1041) | 972305..973399 | - | 1095 | WP_188202013.1 | VIT1/CCC1 transporter family protein | - |
| TIRI35C_RS05235 (TIRI35C_1042) | 973448..974584 | - | 1137 | WP_188202014.1 | tRNA (guanine(10)-N(2))-dimethyltransferase | - |
| TIRI35C_RS05240 (TIRI35C_1043) | 974631..974897 | - | 267 | WP_188203049.1 | 50S ribosomal protein L35ae | - |
| TIRI35C_RS05245 (TIRI35C_1044) | 974940..975608 | - | 669 | WP_188202015.1 | haloacid dehalogenase | - |
| TIRI35C_RS05250 (TIRI35C_1045) | 975730..976776 | + | 1047 | WP_188202016.1 | Xaa-Pro dipeptidase PepQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14833.19 Da Isoelectric Point: 5.2290
>T289469 WP_246454788.1 NZ_LR881183:971913-972308 [Thermococcus camini]
MVIDASVLAKYVLLEPGWERIEELLLKDVVSLDYALAEVSNALWKHHVLYGRISREEFEKRVLVVDAVPNVVILESGLQY
LHHAKSIALEHRITVYDALYIAQALKYGELATSDKEQGKIAEKLGVEVTYL
MVIDASVLAKYVLLEPGWERIEELLLKDVVSLDYALAEVSNALWKHHVLYGRISREEFEKRVLVVDAVPNVVILESGLQY
LHHAKSIALEHRITVYDALYIAQALKYGELATSDKEQGKIAEKLGVEVTYL
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|