Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 136965..137490 Replicon plasmid 83_VP
Accession NZ_LR878366
Organism Shigella flexneri 3a isolate 83

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag JMV05_RS23670 Protein ID WP_001159860.1
Coordinates 136965..137270 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag JMV05_RS23675 Protein ID WP_000813626.1
Coordinates 137272..137490 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV05_RS23645 133616..134206 - 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
JMV05_RS23650 134289..134458 - 170 Protein_166 type II toxin-antitoxin system toxin YacB -
JMV05_RS23655 134458..134727 - 270 WP_000079956.1 type II toxin-antitoxin system antitoxin YacA -
JMV05_RS23660 134935..136572 - 1638 WP_039060807.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
JMV05_RS23665 136834..136941 - 108 WP_023592908.1 transposase domain-containing protein -
JMV05_RS23670 136965..137270 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
JMV05_RS23675 137272..137490 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
JMV05_RS23680 138026..138979 - 954 Protein_172 IS66 family transposase -
JMV05_RS23685 139035..139732 + 698 WP_223368647.1 IS1 family transposase -
JMV05_RS23690 140203..140454 + 252 WP_001381727.1 transporter -
JMV05_RS23695 140504..140713 + 210 Protein_175 peptidoglycan-binding protein -
JMV05_RS23705 141590..141775 - 186 Protein_177 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospD3/senA / ospC1 / ipaH4.5 / ipaH7.8 / ospC2 / icsP/sopA / ospB / ospC3 / ospC4 / ospC2 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 1..231165 231165
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 129129..151061 21932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T289459 WP_001159860.1 NZ_LR878366:c137270-136965 [Shigella flexneri 3a]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT289459 WP_000813626.1 NZ_LR878366:c137490-137272 [Shigella flexneri 3a]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References