Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 118023..118648 | Replicon | plasmid 83_VP |
Accession | NZ_LR878366 | ||
Organism | Shigella flexneri 3a isolate 83 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q7BEJ1 |
Locus tag | JMV05_RS23565 | Protein ID | WP_000911311.1 |
Coordinates | 118250..118648 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q7BEJ0 |
Locus tag | JMV05_RS23560 | Protein ID | WP_000450531.1 |
Coordinates | 118023..118250 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV05_RS23555 | 114722..117941 | - | 3220 | Protein_147 | conjugative transfer relaxase/helicase TraI | - |
JMV05_RS23560 | 118023..118250 | + | 228 | WP_000450531.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
JMV05_RS23565 | 118250..118648 | + | 399 | WP_000911311.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JMV05_RS23570 | 118657..118836 | - | 180 | Protein_150 | hypothetical protein | - |
JMV05_RS23575 | 118881..120037 | + | 1157 | WP_094099560.1 | IS3-like element IS600 family transposase | - |
JMV05_RS23580 | 120082..121005 | + | 924 | Protein_152 | IS630-like element IS630 family transposase | - |
JMV05_RS23585 | 121159..122103 | - | 945 | WP_004996485.1 | lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase | - |
JMV05_RS23590 | 122168..123118 | - | 951 | WP_025760081.1 | virulence factor VirK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ospD3/senA / ospC1 / ipaH4.5 / ipaH7.8 / ospC2 / icsP/sopA / ospB / ospC3 / ospC4 / ospC2 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 | 1..231165 | 231165 | |
- | inside | IScluster/Tn | - | - | 107527..121005 | 13478 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14817.08 Da Isoelectric Point: 8.5232
>T289458 WP_000911311.1 NZ_LR878366:118250-118648 [Shigella flexneri 3a]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGKMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|