Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 46428..47203 Replicon plasmid 83_VP
Accession NZ_LR878366
Organism Shigella flexneri 3a isolate 83

Toxin (Protein)


Gene name tacT Uniprot ID A0A896Z130
Locus tag JMV05_RS23095 Protein ID WP_025759928.1
Coordinates 46721..47203 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q7BEG8
Locus tag JMV05_RS23090 Protein ID WP_010921625.1
Coordinates 46428..46730 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV05_RS23070 42791..44245 + 1455 WP_000701110.1 type 3 secretion system effector OspC2 -
JMV05_RS23075 44394..44522 - 129 Protein_50 IS5/IS1182 family transposase -
JMV05_RS23080 44694..45902 - 1209 WP_162943489.1 IS91 family transposase -
JMV05_RS23085 45883..46156 - 274 Protein_52 hypothetical protein -
JMV05_RS23090 46428..46730 + 303 WP_010921625.1 DUF1778 domain-containing protein Antitoxin
JMV05_RS23095 46721..47203 + 483 WP_025759928.1 GNAT family N-acetyltransferase Toxin
JMV05_RS23100 47277..47800 + 524 Protein_55 transposase -
JMV05_RS23105 47843..48181 - 339 Protein_56 integrase core domain-containing protein -
JMV05_RS23110 48255..49423 + 1169 WP_161550577.1 IS3-like element IS911 family transposase -
JMV05_RS23115 49447..50190 - 744 WP_256377549.1 NleE/OspZ family T3SS effector cysteine methyltransferase -
JMV05_RS23120 50110..50807 + 698 WP_225620296.1 IS1 family transposase -
JMV05_RS23125 50824..50916 - 93 Protein_60 T3SS effector protein NleE -
JMV05_RS23130 50972..51124 + 153 Protein_61 integrase core domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospD3/senA / ospC1 / ipaH4.5 / ipaH7.8 / ospC2 / icsP/sopA / ospB / ospC3 / ospC4 / ospC2 / ospD2 / ospF / ospD1 / ipgB2 / ospE2 / ipaH2.5 / ospE1 / ipaH1.4 / ospG / ipaH9.8 / ospI / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 1..231165 231165
- inside IScluster/Tn - ospC2 / icsP/sopA / ospB / ospC3 / ospC4 / ospC2 37855..60326 22471


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(29-149)

Antitoxin

Vibrio phage ICP1, Orf50

(19-94)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17749.54 Da        Isoelectric Point: 7.4014

>T289457 WP_025759928.1 NZ_LR878366:46721-47203 [Shigella flexneri 3a]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEDTLRIVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDNARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11689.28 Da        Isoelectric Point: 4.9167

>AT289457 WP_010921625.1 NZ_LR878366:46428-46730 [Shigella flexneri 3a]
MEVFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRTDFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A896Z130

Antitoxin

Source ID Structure
AlphaFold DB Q7BEG8

References