Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3414578..3415415 | Replicon | chromosome |
Accession | NZ_LR878365 | ||
Organism | Shigella flexneri 3a isolate 83 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | JMV05_RS17440 | Protein ID | WP_025758752.1 |
Coordinates | 3414873..3415415 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A0A658YW11 |
Locus tag | JMV05_RS17435 | Protein ID | WP_005072928.1 |
Coordinates | 3414578..3414889 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV05_RS17400 (3409683) | 3409683..3411284 | - | 1602 | WP_040235286.1 | IS66-like element ISSfl3 family transposase | - |
JMV05_RS17405 (3411304) | 3411304..3411651 | - | 348 | WP_000631709.1 | IS66 family insertion sequence element accessory protein TnpB | - |
JMV05_RS17410 (3411648) | 3411648..3412322 | - | 675 | WP_001088287.1 | IS66-like element accessory protein TnpA | - |
JMV05_RS17415 (3412406) | 3412406..3412558 | + | 153 | Protein_3399 | hypothetical protein | - |
JMV05_RS17420 (3412548) | 3412548..3413162 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
JMV05_RS17425 (3413162) | 3413162..3413491 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
JMV05_RS17430 (3413503) | 3413503..3414393 | + | 891 | WP_025758754.1 | heme o synthase | - |
JMV05_RS17435 (3414578) | 3414578..3414889 | + | 312 | WP_005072928.1 | DUF1778 domain-containing protein | Antitoxin |
JMV05_RS17440 (3414873) | 3414873..3415415 | + | 543 | WP_025758752.1 | GNAT family N-acetyltransferase | Toxin |
JMV05_RS17445 (3415471) | 3415471..3416406 | - | 936 | WP_024259953.1 | tetratricopeptide repeat protein | - |
JMV05_RS17450 (3416417) | 3416417..3416650 | - | 234 | WP_134800446.1 | hypothetical protein | - |
JMV05_RS17455 (3416643) | 3416643..3416963 | - | 321 | WP_225620339.1 | hypothetical protein | - |
JMV05_RS17460 (3416969) | 3416969..3417919 | - | 951 | WP_225620340.1 | tetratricopeptide repeat protein | - |
JMV05_RS17465 (3418313) | 3418313..3419683 | + | 1371 | WP_119182053.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19835.99 Da Isoelectric Point: 8.6178
>T289455 WP_025758752.1 NZ_LR878365:3414873-3415415 [Shigella flexneri 3a]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLER
QRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKKIHQALPIKGVYLDADPATINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLER
QRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKKIHQALPIKGVYLDADPATINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|