Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2731759..2732554 | Replicon | chromosome |
| Accession | NZ_LR878365 | ||
| Organism | Shigella flexneri 3a isolate 83 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B7UP43 |
| Locus tag | JMV05_RS13950 | Protein ID | WP_000854914.1 |
| Coordinates | 2731759..2732133 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9LM11 |
| Locus tag | JMV05_RS13955 | Protein ID | WP_001280953.1 |
| Coordinates | 2732180..2732554 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV05_RS13910 (2726763) | 2726763..2727254 | - | 492 | WP_001297187.1 | DUF1097 domain-containing protein | - |
| JMV05_RS13915 (2727356) | 2727356..2727910 | - | 555 | WP_001001917.1 | molecular chaperone YcdY | - |
| JMV05_RS13920 (2727934) | 2727934..2728671 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| JMV05_RS13925 (2728726) | 2728726..2729664 | - | 939 | Protein_2723 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| JMV05_RS13935 (2730135) | 2730135..2730977 | - | 843 | WP_053884962.1 | DUF4942 domain-containing protein | - |
| JMV05_RS13940 (2731062) | 2731062..2731259 | - | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| JMV05_RS13945 (2731271) | 2731271..2731762 | - | 492 | WP_000976857.1 | DUF5983 family protein | - |
| JMV05_RS13950 (2731759) | 2731759..2732133 | - | 375 | WP_000854914.1 | TA system toxin CbtA family protein | Toxin |
| JMV05_RS13955 (2732180) | 2732180..2732554 | - | 375 | WP_001280953.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| JMV05_RS13960 (2732717) | 2732717..2732938 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| JMV05_RS13965 (2733001) | 2733001..2733477 | - | 477 | WP_001186738.1 | RadC family protein | - |
| JMV05_RS13970 (2733493) | 2733493..2733978 | - | 486 | WP_000214398.1 | antirestriction protein | - |
| JMV05_RS13975 (2734069) | 2734069..2734539 | - | 471 | Protein_2732 | DUF945 domain-containing protein | - |
| JMV05_RS13985 (2735849) | 2735849..2736290 | + | 442 | Protein_2734 | IS200/IS605 family transposase | - |
| JMV05_RS13990 (2736408) | 2736408..2737346 | - | 939 | WP_052961806.1 | hypochlorite stress DNA-binding transcriptional regulator HypT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | ant(3'')-Ia / blaOXA-1 / catA1 / tet(B) | csgC / csgA / csgB / csgD / csgE / csgF / csgG | 2720273..2785264 | 64991 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14117.17 Da Isoelectric Point: 7.7761
>T289452 WP_000854914.1 NZ_LR878365:c2732133-2731759 [Shigella flexneri 3a]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13734.56 Da Isoelectric Point: 6.6249
>AT289452 WP_001280953.1 NZ_LR878365:c2732554-2732180 [Shigella flexneri 3a]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPALATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPALATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LXR5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LM11 |