289452

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2731759..2732554 Replicon chromosome
Accession NZ_LR878365
Organism Shigella flexneri 3a isolate 83

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag JMV05_RS13950 Protein ID WP_000854914.1
Coordinates 2731759..2732133 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7U9LM11
Locus tag JMV05_RS13955 Protein ID WP_001280953.1
Coordinates 2732180..2732554 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV05_RS13910 (2726763) 2726763..2727254 - 492 WP_001297187.1 DUF1097 domain-containing protein -
JMV05_RS13915 (2727356) 2727356..2727910 - 555 WP_001001917.1 molecular chaperone YcdY -
JMV05_RS13920 (2727934) 2727934..2728671 - 738 WP_000283664.1 zinc-binding phosphatase -
JMV05_RS13925 (2728726) 2728726..2729664 - 939 Protein_2723 glyoxylate/hydroxypyruvate reductase GhrA -
JMV05_RS13935 (2730135) 2730135..2730977 - 843 WP_053884962.1 DUF4942 domain-containing protein -
JMV05_RS13940 (2731062) 2731062..2731259 - 198 WP_000839282.1 DUF957 domain-containing protein -
JMV05_RS13945 (2731271) 2731271..2731762 - 492 WP_000976857.1 DUF5983 family protein -
JMV05_RS13950 (2731759) 2731759..2732133 - 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
JMV05_RS13955 (2732180) 2732180..2732554 - 375 WP_001280953.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
JMV05_RS13960 (2732717) 2732717..2732938 - 222 WP_000692323.1 DUF987 domain-containing protein -
JMV05_RS13965 (2733001) 2733001..2733477 - 477 WP_001186738.1 RadC family protein -
JMV05_RS13970 (2733493) 2733493..2733978 - 486 WP_000214398.1 antirestriction protein -
JMV05_RS13975 (2734069) 2734069..2734539 - 471 Protein_2732 DUF945 domain-containing protein -
JMV05_RS13985 (2735849) 2735849..2736290 + 442 Protein_2734 IS200/IS605 family transposase -
JMV05_RS13990 (2736408) 2736408..2737346 - 939 WP_052961806.1 hypochlorite stress DNA-binding transcriptional regulator HypT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island ant(3'')-Ia / blaOXA-1 / catA1 / tet(B) csgC / csgA / csgB / csgD / csgE / csgF / csgG 2720273..2785264 64991


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T289452 WP_000854914.1 NZ_LR878365:c2732133-2731759 [Shigella flexneri 3a]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13734.56 Da        Isoelectric Point: 6.6249

>AT289452 WP_001280953.1 NZ_LR878365:c2732554-2732180 [Shigella flexneri 3a]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPALATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LM11

References