Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2291794..2292320 | Replicon | chromosome |
| Accession | NZ_LR878365 | ||
| Organism | Shigella flexneri 3a isolate 83 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | JMV05_RS11600 | Protein ID | WP_000323025.1 |
| Coordinates | 2291794..2292081 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | JMV05_RS11605 | Protein ID | WP_000534858.1 |
| Coordinates | 2292081..2292320 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV05_RS11550 (2286854) | 2286854..2287189 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
| JMV05_RS11555 (2287470) | 2287470..2287556 | - | 87 | WP_000115835.1 | DUF3927 family protein | - |
| JMV05_RS11570 (2288498) | 2288498..2289319 | - | 822 | WP_000762884.1 | antitermination protein | - |
| JMV05_RS11575 (2289334) | 2289334..2289690 | - | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JMV05_RS11580 (2289703) | 2289703..2290752 | - | 1050 | WP_025759563.1 | DUF968 domain-containing protein | - |
| JMV05_RS11585 (2290754) | 2290754..2291032 | - | 279 | WP_024258459.1 | hypothetical protein | - |
| JMV05_RS11590 (2291099) | 2291099..2291349 | - | 251 | Protein_2264 | hypothetical protein | - |
| JMV05_RS11595 (2291567) | 2291567..2291722 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| JMV05_RS11600 (2291794) | 2291794..2292081 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| JMV05_RS11605 (2292081) | 2292081..2292320 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| JMV05_RS11610 (2292345) | 2292345..2292650 | + | 306 | WP_071818640.1 | hypothetical protein | - |
| JMV05_RS11620 (2293867) | 2293867..2294225 | + | 359 | Protein_2270 | type 1 fimbrial protein | - |
| JMV05_RS11625 (2294238) | 2294238..2294603 | + | 366 | Protein_2271 | type 1 fimbrial protein | - |
| JMV05_RS11630 (2294678) | 2294678..2294887 | - | 210 | Protein_2272 | IS1 family transposase | - |
| JMV05_RS11635 (2294952) | 2294952..2296161 | - | 1210 | Protein_2273 | IS3 family transposase | - |
| JMV05_RS11640 (2296153) | 2296153..2296704 | - | 552 | Protein_2274 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2270151..2296510 | 26359 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T289451 WP_000323025.1 NZ_LR878365:c2292081-2291794 [Shigella flexneri 3a]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|