Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 848507..849161 | Replicon | chromosome |
| Accession | NZ_LR878365 | ||
| Organism | Shigella flexneri 3a isolate 83 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q0T101 |
| Locus tag | JMV05_RS04215 | Protein ID | WP_000244767.1 |
| Coordinates | 848754..849161 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | Q0T100 |
| Locus tag | JMV05_RS04210 | Protein ID | WP_000354044.1 |
| Coordinates | 848507..848773 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMV05_RS04185 (843676) | 843676..844419 | + | 744 | WP_119182047.1 | SDR family oxidoreductase | - |
| JMV05_RS04190 (844476) | 844476..845909 | - | 1434 | WP_005076748.1 | 6-phospho-beta-glucosidase BglA | - |
| JMV05_RS04195 (845954) | 845954..846265 | + | 312 | WP_001182950.1 | N(4)-acetylcytidine aminohydrolase | - |
| JMV05_RS04200 (846429) | 846429..847088 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| JMV05_RS04205 (847284) | 847284..848264 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| JMV05_RS04210 (848507) | 848507..848773 | + | 267 | WP_000354044.1 | FAD assembly factor SdhE | Antitoxin |
| JMV05_RS04215 (848754) | 848754..849161 | + | 408 | WP_000244767.1 | protein YgfX | Toxin |
| JMV05_RS04220 (849201) | 849201..849722 | - | 522 | WP_001055867.1 | flavodoxin FldB | - |
| JMV05_RS04225 (849834) | 849834..850730 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| JMV05_RS04230 (850755) | 850755..851465 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| JMV05_RS04235 (851471) | 851471..853204 | + | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T289443 WP_000244767.1 NZ_LR878365:848754-849161 [Shigella flexneri 3a]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TIU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TIU2 |