Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 72819..73363 | Replicon | chromosome |
| Accession | NZ_LR861807 | ||
| Organism | Xanthomonas arboricola pv. juglandis isolate 3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2N7V9Q0 |
| Locus tag | H5027_RS00260 | Protein ID | WP_016902923.1 |
| Coordinates | 73064..73363 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2N7V9L6 |
| Locus tag | H5027_RS00255 | Protein ID | WP_016902922.1 |
| Coordinates | 72819..73076 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H5027_RS00240 | 67927..69435 | - | 1509 | WP_016904858.1 | ribonuclease H-like domain-containing protein | - |
| H5027_RS00245 | 69432..71927 | - | 2496 | WP_016904859.1 | DEAD/DEAH box helicase | - |
| H5027_RS00250 | 72101..72763 | + | 663 | WP_039511099.1 | hemolysin III family protein | - |
| H5027_RS00255 | 72819..73076 | + | 258 | WP_016902922.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| H5027_RS00260 | 73064..73363 | + | 300 | WP_016902923.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| H5027_RS00265 | 73482..73976 | - | 495 | WP_026064422.1 | hypothetical protein | - |
| H5027_RS00270 | 74173..74511 | - | 339 | Protein_53 | helix-turn-helix transcriptional regulator | - |
| H5027_RS00275 | 74525..74767 | + | 243 | WP_053051357.1 | hypothetical protein | - |
| H5027_RS00280 | 74927..76018 | - | 1092 | WP_053051360.1 | hypothetical protein | - |
| H5027_RS00285 | 76474..77187 | + | 714 | WP_053054205.1 | hypothetical protein | - |
| H5027_RS00290 | 77198..78091 | - | 894 | WP_053046150.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11336.04 Da Isoelectric Point: 9.0225
>T289438 WP_016902923.1 NZ_LR861807:73064-73363 [Xanthomonas arboricola pv. juglandis]
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVFAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRKNRLSR
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVFAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRKNRLSR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2N7V9Q0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2N7V9L6 |