Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4800541..4801208 | Replicon | chromosome |
Accession | NZ_LR861805 | ||
Organism | Xanthomonas sp. CPBF 426 isolate |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | H7A87_RS20290 | Protein ID | WP_102582219.1 |
Coordinates | 4800792..4801208 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | H7A87_RS20285 | Protein ID | WP_102582218.1 |
Coordinates | 4800541..4800795 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7A87_RS20260 | 4795997..4796836 | + | 840 | WP_119129942.1 | SDR family oxidoreductase | - |
H7A87_RS20265 | 4796987..4798252 | + | 1266 | WP_180496822.1 | cardiolipin synthase B | - |
H7A87_RS20270 | 4798295..4798831 | - | 537 | WP_119129943.1 | hypothetical protein | - |
H7A87_RS20275 | 4799099..4799305 | + | 207 | WP_119129944.1 | hypothetical protein | - |
H7A87_RS20280 | 4799292..4800404 | + | 1113 | WP_119129945.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
H7A87_RS20285 | 4800541..4800795 | + | 255 | WP_102582218.1 | Arc family DNA-binding protein | Antitoxin |
H7A87_RS20290 | 4800792..4801208 | + | 417 | WP_102582219.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
H7A87_RS20295 | 4801333..4801893 | - | 561 | WP_104586335.1 | hypothetical protein | - |
H7A87_RS20300 | 4802591..4804216 | + | 1626 | WP_119129946.1 | enterochelin esterase | - |
H7A87_RS20305 | 4804299..4804700 | - | 402 | WP_126968946.1 | DUF2384 domain-containing protein | - |
H7A87_RS20310 | 4805005..4805460 | + | 456 | WP_180496823.1 | hypothetical protein | - |
H7A87_RS20315 | 4805489..4805812 | - | 324 | WP_119129948.1 | hypothetical protein | - |
H7A87_RS20320 | 4805924..4806169 | + | 246 | WP_115045825.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14754.04 Da Isoelectric Point: 5.6845
>T289437 WP_102582219.1 NZ_LR861805:4800792-4801208 [Xanthomonas sp. CPBF 426]
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|