Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 65665..66209 | Replicon | chromosome |
| Accession | NZ_LR861805 | ||
| Organism | Xanthomonas sp. CPBF 426 isolate | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | H7A87_RS00240 | Protein ID | WP_104585946.1 |
| Coordinates | 65910..66209 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | H7A87_RS00235 | Protein ID | WP_104585948.1 |
| Coordinates | 65665..65922 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7A87_RS00225 | 62266..64761 | - | 2496 | WP_166766693.1 | DEAD/DEAH box helicase | - |
| H7A87_RS00230 | 64935..65597 | + | 663 | WP_104585950.1 | hemolysin III family protein | - |
| H7A87_RS00235 | 65665..65922 | + | 258 | WP_104585948.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| H7A87_RS00240 | 65910..66209 | + | 300 | WP_104585946.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| H7A87_RS00245 | 66221..66739 | - | 519 | WP_119127188.1 | hypothetical protein | - |
| H7A87_RS00250 | 66929..68026 | - | 1098 | WP_119127189.1 | hypothetical protein | - |
| H7A87_RS00255 | 68377..69021 | + | 645 | WP_104650099.1 | glutathione S-transferase family protein | - |
| H7A87_RS00260 | 69171..69878 | + | 708 | WP_119127190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11316.00 Da Isoelectric Point: 9.0380
>T289435 WP_104585946.1 NZ_LR861805:65910-66209 [Xanthomonas sp. CPBF 426]
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVVAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRRNRLSR
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVVAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRRNRLSR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|