Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4841834..4842501 | Replicon | chromosome |
Accession | NZ_LR861803 | ||
Organism | Xanthomonas euroxanthea isolate |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | H7A86_RS20170 | Protein ID | WP_102582219.1 |
Coordinates | 4842085..4842501 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | H7A86_RS20165 | Protein ID | WP_102582218.1 |
Coordinates | 4841834..4842088 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7A86_RS20145 | 4838283..4839548 | + | 1266 | WP_164739643.1 | cardiolipin synthase B | - |
H7A86_RS20150 | 4839591..4840127 | - | 537 | WP_119132629.1 | hypothetical protein | - |
H7A86_RS20155 | 4840397..4840603 | + | 207 | WP_104586339.1 | hypothetical protein | - |
H7A86_RS20160 | 4840590..4841696 | + | 1107 | WP_119132630.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
H7A86_RS20165 | 4841834..4842088 | + | 255 | WP_102582218.1 | Arc family DNA-binding protein | Antitoxin |
H7A86_RS20170 | 4842085..4842501 | + | 417 | WP_102582219.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
H7A86_RS20175 | 4842627..4843187 | - | 561 | WP_119132631.1 | hypothetical protein | - |
H7A86_RS20180 | 4843885..4845510 | + | 1626 | WP_119132632.1 | enterochelin esterase | - |
H7A86_RS20185 | 4845593..4845994 | - | 402 | WP_126968946.1 | DUF2384 domain-containing protein | - |
H7A86_RS20190 | 4846299..4846754 | + | 456 | WP_180707969.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4836221..4856411 | 20190 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14754.04 Da Isoelectric Point: 5.6845
>T289434 WP_102582219.1 NZ_LR861803:4842085-4842501 [Xanthomonas euroxanthea]
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
VILLDTNVISELWRPQPNPKVVAWIDAQAVETLFLSVVTVAELRFGIAVMPEGRKRSTLHARLESDVLPLFNGRLLAFDL
DASHAFATLASKARAAGLTLGRADAYIAATAAAQGLTVATRDTAPFAAMALDVIDPWS
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|