Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 65955..66499 | Replicon | chromosome |
Accession | NZ_LR861803 | ||
Organism | Xanthomonas euroxanthea isolate |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | H7A86_RS00245 | Protein ID | WP_104585946.1 |
Coordinates | 66200..66499 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | H7A86_RS00240 | Protein ID | WP_104585948.1 |
Coordinates | 65955..66212 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H7A86_RS00230 | 62556..65051 | - | 2496 | WP_180707976.1 | DEAD/DEAH box helicase | - |
H7A86_RS00235 | 65225..65887 | + | 663 | WP_119130032.1 | hemolysin III family protein | - |
H7A86_RS00240 | 65955..66212 | + | 258 | WP_104585948.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
H7A86_RS00245 | 66200..66499 | + | 300 | WP_104585946.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
H7A86_RS00250 | 66512..67042 | - | 531 | WP_119130033.1 | hypothetical protein | - |
H7A86_RS00255 | 67227..68312 | - | 1086 | WP_119130579.1 | hypothetical protein | - |
H7A86_RS00260 | 68665..69309 | + | 645 | WP_119130034.1 | glutathione S-transferase family protein | - |
H7A86_RS00265 | 69459..70166 | + | 708 | WP_119130035.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11316.00 Da Isoelectric Point: 9.0380
>T289432 WP_104585946.1 NZ_LR861803:66200-66499 [Xanthomonas euroxanthea]
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVVAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRRNRLSR
MAEIVWSEPAVADLDAIADYIALEDAAAAAALVRRVVAHVEQLAEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRV
VVVHVMRSERLLRRNRLSR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|