Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 2197421..2197926 | Replicon | chromosome |
Accession | NZ_LR828257 | ||
Organism | Xanthomonas hortorum pv. vitians strain CFBP 498 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6V7D3A5 |
Locus tag | CFBP8129_RS09675 | Protein ID | WP_074056859.1 |
Coordinates | 2197421..2197678 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relE | Uniprot ID | F0BZS9 |
Locus tag | CFBP8129_RS09680 | Protein ID | WP_006448404.1 |
Coordinates | 2197675..2197926 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP8129_RS09650 | 2193120..2194475 | + | 1356 | WP_074056857.1 | aminodeoxychorismate synthase component I | - |
CFBP8129_RS09655 | 2194491..2195600 | + | 1110 | WP_074056858.1 | endolytic transglycosylase MltG | - |
CFBP8129_RS09660 | 2195597..2196556 | + | 960 | WP_180313645.1 | DNA polymerase III subunit delta' | - |
CFBP8129_RS09665 | 2196553..2196906 | + | 354 | WP_003483889.1 | PilZ domain-containing protein | - |
CFBP8129_RS09675 | 2197421..2197678 | - | 258 | WP_074056859.1 | Txe/YoeB family addiction module toxin | Toxin |
CFBP8129_RS09680 | 2197675..2197926 | - | 252 | WP_006448404.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
CFBP8129_RS09685 | 2198112..2198438 | + | 327 | WP_180313646.1 | hypothetical protein | - |
CFBP8129_RS09690 | 2198681..2200300 | - | 1620 | WP_174555969.1 | propionate catabolism operon regulatory protein PrpR | - |
CFBP8129_RS09695 | 2200429..2201325 | + | 897 | WP_074056861.1 | methylisocitrate lyase | - |
CFBP8129_RS09700 | 2201401..2202555 | + | 1155 | WP_074056862.1 | 2-methylcitrate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10156.66 Da Isoelectric Point: 9.6587
>T289430 WP_074056859.1 NZ_LR828257:c2197678-2197421 [Xanthomonas hortorum pv. vitians]
VILQFADNAWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYG
VILQFADNAWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYG
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6V7D3A5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0G8MAJ7 |