Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 3811213..3811718 | Replicon | chromosome |
Accession | NZ_LR828253 | ||
Organism | Xanthomonas hortorum pv. gardneri strain CFBP 8129 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F0BZT0 |
Locus tag | CFBP498_RS16055 | Protein ID | WP_006448405.1 |
Coordinates | 3811461..3811718 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relE | Uniprot ID | F0BZS9 |
Locus tag | CFBP498_RS16050 | Protein ID | WP_006448404.1 |
Coordinates | 3811213..3811464 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CFBP498_RS16030 (CFBP8129_32720) | 3806584..3807738 | - | 1155 | WP_006448400.1 | 2-methylcitrate synthase | - |
CFBP498_RS16035 (CFBP8129_32730) | 3807814..3808710 | - | 897 | WP_006448401.1 | methylisocitrate lyase | - |
CFBP498_RS16040 (CFBP8129_32740) | 3808857..3810458 | + | 1602 | WP_006448402.1 | propionate catabolism operon regulatory protein PrpR | - |
CFBP498_RS16045 (CFBP8129_32750) | 3810701..3811027 | - | 327 | WP_006448403.1 | hypothetical protein | - |
CFBP498_RS16050 (CFBP8129_32760) | 3811213..3811464 | + | 252 | WP_006448404.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
CFBP498_RS16055 (CFBP8129_32770) | 3811461..3811718 | + | 258 | WP_006448405.1 | Txe/YoeB family addiction module toxin | Toxin |
CFBP498_RS16065 (CFBP8129_32790) | 3812250..3812603 | - | 354 | WP_003483889.1 | PilZ domain-containing protein | - |
CFBP498_RS16070 (CFBP8129_32800) | 3812600..3813559 | - | 960 | WP_006448409.1 | DNA polymerase III subunit delta' | - |
CFBP498_RS16075 (CFBP8129_32810) | 3813556..3814608 | - | 1053 | WP_228996226.1 | endolytic transglycosylase MltG | - |
CFBP498_RS16080 (CFBP8129_32820) | 3814681..3816036 | - | 1356 | WP_006448411.1 | aminodeoxychorismate synthase component I | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10200.71 Da Isoelectric Point: 9.6587
>T289425 WP_006448405.1 NZ_LR828253:3811461-3811718 [Xanthomonas hortorum pv. gardneri]
VILQFADNTWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYA
VILQFADNTWEDYLYWQQTDKKMLKRINELIKAIQRDPFQGIGKPEPLRHALAGYWSRRINDEHRIVYKAENGILLIAQA
RYHYA
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6V7E8S3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0G8MAJ7 |