Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2890744..2891273 | Replicon | chromosome |
| Accession | NZ_LR822061 | ||
| Organism | Staphylococcus aureus isolate HU-14 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | BKMNNEJI_RS14560 | Protein ID | WP_000621175.1 |
| Coordinates | 2890911..2891273 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | BKMNNEJI_RS14555 | Protein ID | WP_000948331.1 |
| Coordinates | 2890744..2890914 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BKMNNEJI_RS14525 | 2885781..2886341 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
| BKMNNEJI_RS14530 | 2886549..2887028 | + | 480 | WP_001287087.1 | hypothetical protein | - |
| BKMNNEJI_RS14535 | 2887021..2888604 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| BKMNNEJI_RS14540 | 2888591..2889082 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
| BKMNNEJI_RS14545 | 2889086..2889445 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| BKMNNEJI_RS14550 | 2889511..2890659 | + | 1149 | WP_001281154.1 | alanine racemase | - |
| BKMNNEJI_RS14555 | 2890744..2890914 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| BKMNNEJI_RS14560 | 2890911..2891273 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| BKMNNEJI_RS14565 | 2891623..2892624 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| BKMNNEJI_RS14570 | 2892743..2893069 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| BKMNNEJI_RS14575 | 2893071..2893550 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| BKMNNEJI_RS14580 | 2893525..2894295 | + | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T289424 WP_000621175.1 NZ_LR822061:2890911-2891273 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|