Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1279599..1280076 Replicon chromosome
Accession NZ_LR822061
Organism Staphylococcus aureus isolate HU-14

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag BKMNNEJI_RS06605 Protein ID WP_000052076.1
Coordinates 1279888..1280076 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag BKMNNEJI_RS06600 Protein ID WP_001059690.1
Coordinates 1279599..1279859 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BKMNNEJI_RS06565 1274992..1275708 - 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -
BKMNNEJI_RS06570 1275856..1276278 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
BKMNNEJI_RS06575 1276677..1277171 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
BKMNNEJI_RS06580 1277326..1277943 + 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
BKMNNEJI_RS06585 1278016..1278597 - 582 WP_001140693.1 phosphoglycerate mutase family protein -
BKMNNEJI_RS06590 1278822..1279058 + 237 WP_000349581.1 hypothetical protein -
BKMNNEJI_RS06595 1279055..1279258 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
BKMNNEJI_RS06600 1279599..1279859 + 261 WP_001059690.1 hypothetical protein Antitoxin
BKMNNEJI_RS06605 1279888..1280076 + 189 WP_000052076.1 hypothetical protein Toxin
BKMNNEJI_RS06610 1280264..1280833 + 570 WP_001106645.1 hypothetical protein -
BKMNNEJI_RS06615 1280921..1281205 + 285 WP_001004399.1 hypothetical protein -
BKMNNEJI_RS06620 1281267..1281485 + 219 WP_000005886.1 hypothetical protein -
BKMNNEJI_RS06625 1281977..1282177 - 201 WP_001059082.1 cold-shock protein -
BKMNNEJI_RS06630 1282534..1283220 - 687 WP_000141557.1 thermonuclease family protein -
BKMNNEJI_RS06635 1283561..1284082 - 522 WP_000824485.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 1251585..1310459 58874


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T289414 WP_000052076.1 NZ_LR822061:1279888-1280076 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT289414 WP_001059690.1 NZ_LR822061:1279599-1279859 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References