Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2889409..2889938 | Replicon | chromosome |
| Accession | NZ_LR822060 | ||
| Organism | Staphylococcus aureus isolate P3.1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | LJDFIFNA_RS14580 | Protein ID | WP_000621175.1 |
| Coordinates | 2889576..2889938 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | LJDFIFNA_RS14575 | Protein ID | WP_000948331.1 |
| Coordinates | 2889409..2889579 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJDFIFNA_RS14545 | 2884446..2885006 | + | 561 | WP_001092411.1 | K(+)-transporting ATPase subunit C | - |
| LJDFIFNA_RS14550 | 2885214..2885693 | + | 480 | WP_001287087.1 | hypothetical protein | - |
| LJDFIFNA_RS14555 | 2885686..2887269 | + | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| LJDFIFNA_RS14560 | 2887256..2887747 | + | 492 | WP_001205912.1 | PH domain-containing protein | - |
| LJDFIFNA_RS14565 | 2887751..2888110 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| LJDFIFNA_RS14570 | 2888176..2889324 | + | 1149 | WP_001281154.1 | alanine racemase | - |
| LJDFIFNA_RS14575 | 2889409..2889579 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| LJDFIFNA_RS14580 | 2889576..2889938 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| LJDFIFNA_RS14585 | 2890288..2891289 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| LJDFIFNA_RS14590 | 2891408..2891734 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| LJDFIFNA_RS14595 | 2891736..2892215 | + | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| LJDFIFNA_RS14600 | 2892190..2892960 | + | 771 | WP_001041111.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T289404 WP_000621175.1 NZ_LR822060:2889576-2889938 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|