Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1278264..1278741 Replicon chromosome
Accession NZ_LR822060
Organism Staphylococcus aureus isolate P3.1

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag LJDFIFNA_RS06605 Protein ID WP_000052076.1
Coordinates 1278553..1278741 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag LJDFIFNA_RS06600 Protein ID WP_001059690.1
Coordinates 1278264..1278524 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LJDFIFNA_RS06565 1273657..1274373 - 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -
LJDFIFNA_RS06570 1274521..1274943 + 423 WP_000974460.1 organic hydroperoxide resistance protein -
LJDFIFNA_RS06575 1275342..1275836 + 495 WP_000569884.1 GNAT family N-acetyltransferase -
LJDFIFNA_RS06580 1275991..1276608 + 618 WP_000255551.1 LysE/ArgO family amino acid transporter -
LJDFIFNA_RS06585 1276681..1277262 - 582 WP_001140693.1 phosphoglycerate mutase family protein -
LJDFIFNA_RS06590 1277487..1277723 + 237 WP_000349581.1 hypothetical protein -
LJDFIFNA_RS06595 1277720..1277923 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
LJDFIFNA_RS06600 1278264..1278524 + 261 WP_001059690.1 hypothetical protein Antitoxin
LJDFIFNA_RS06605 1278553..1278741 + 189 WP_000052076.1 hypothetical protein Toxin
LJDFIFNA_RS06610 1278929..1279498 + 570 WP_001106645.1 hypothetical protein -
LJDFIFNA_RS06615 1279586..1279870 + 285 WP_001004399.1 hypothetical protein -
LJDFIFNA_RS06620 1279932..1280150 + 219 WP_000005886.1 hypothetical protein -
LJDFIFNA_RS06625 1280642..1280842 - 201 WP_001059082.1 cold-shock protein -
LJDFIFNA_RS06630 1281199..1281885 - 687 WP_000141557.1 thermonuclease family protein -
LJDFIFNA_RS06635 1282226..1282747 - 522 WP_000824485.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T289394 WP_000052076.1 NZ_LR822060:1278553-1278741 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT289394 WP_001059690.1 NZ_LR822060:1278264-1278524 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References