Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relB/YoeB-YefM
Location 1180128..1180630 Replicon chromosome
Accession NZ_LR813086
Organism Comamonas aquatica isolate BB1454

Toxin (Protein)


Gene name yoeB Uniprot ID Q5XQD8
Locus tag L1X59_RS05690 Protein ID WP_032492620.1
Coordinates 1180376..1180630 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V0BEH6
Locus tag L1X59_RS05685 Protein ID WP_032492621.1
Coordinates 1180128..1180379 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L1X59_RS05645 (TML_01113) 1175513..1175848 - 336 WP_011518936.1 molecular chaperone DnaK -
L1X59_RS05650 (TML_01114) 1175865..1176281 - 417 WP_234687952.1 universal stress protein -
L1X59_RS05655 (TML_01115) 1176372..1177136 - 765 WP_001389365.1 IS6-like element IS6100 family transposase -
L1X59_RS05660 (TML_01116) 1177311..1178150 - 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
L1X59_RS05665 1178144..1178491 - 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
L1X59_RS05670 (TML_01117) 1178648..1179280 - 633 WP_000186237.1 type B-3 chloramphenicol O-acetyltransferase CatB3 -
L1X59_RS05675 (TML_01118) 1179464..1179715 + 252 WP_032492621.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
L1X59_RS05680 (TML_01119) 1179712..1179966 + 255 WP_032492620.1 Txe/YoeB family addiction module toxin -
L1X59_RS05685 (TML_01120) 1180128..1180379 + 252 WP_032492621.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
L1X59_RS05690 (TML_01121) 1180376..1180630 + 255 WP_032492620.1 Txe/YoeB family addiction module toxin Toxin
L1X59_RS05695 1180703..1181257 - 555 WP_003159191.1 aminoglycoside N-acetyltransferase AAC(6')-Ib4 -
L1X59_RS05700 1181403..1181876 - 474 WP_001389366.1 trimethoprim-resistant dihydrofolate reductase DfrA17 -
L1X59_RS05705 1182034..1182333 + 300 Protein_1108 class 1 integron integrase IntI1 -
L1X59_RS05710 1182334..1182687 + 354 Protein_1109 TCP-1/cpn60 chaperonin family protein -
L1X59_RS05715 (TML_01123) 1182962..1184191 + 1230 Protein_1110 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element sul1 / catB3 / aph(6)-Id / aph(3'')-Ib / mph(E) / msr(E) - 1149467..1331789 182322
- inside Integron catB3 - 1178594..1181408 2814


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10272.81 Da        Isoelectric Point: 9.3585

>T289379 WP_032492620.1 NZ_LR813086:1180376-1180630 [Comamonas aquatica]
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9244.40 Da        Isoelectric Point: 4.7769

>AT289379 WP_032492621.1 NZ_LR813086:1180128-1180379 [Comamonas aquatica]
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V0BEH9

Antitoxin

Source ID Structure
AlphaFold DB A0A1V0BEH6

References