Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 872134..872714 | Replicon | chromosome |
Accession | NZ_LR813084 | ||
Organism | Delftia tsuruhatensis isolate BB1455 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | L1Z78_RS03995 | Protein ID | WP_234640265.1 |
Coordinates | 872134..872514 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A072THC0 |
Locus tag | L1Z78_RS04000 | Protein ID | WP_016448366.1 |
Coordinates | 872511..872714 (-) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L1Z78_RS03975 (TML_00795) | 867457..868698 | + | 1242 | WP_234640261.1 | ABC transporter substrate-binding protein | - |
L1Z78_RS03980 (TML_00796) | 868695..869453 | + | 759 | WP_234640262.1 | ABC transporter permease | - |
L1Z78_RS03985 (TML_00797) | 869488..871074 | - | 1587 | WP_234640263.1 | Ig-like domain repeat protein | - |
L1Z78_RS03990 (TML_00798) | 871304..872056 | + | 753 | WP_234640264.1 | helix-turn-helix transcriptional regulator | - |
L1Z78_RS03995 (TML_00799) | 872134..872514 | - | 381 | WP_234640265.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
L1Z78_RS04000 (TML_00800) | 872511..872714 | - | 204 | WP_016448366.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
L1Z78_RS04005 (TML_00801) | 872865..873677 | + | 813 | WP_234640266.1 | glucose 1-dehydrogenase | - |
L1Z78_RS04010 (TML_00802) | 873795..875462 | + | 1668 | WP_234640267.1 | VRR-NUC domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13833.26 Da Isoelectric Point: 8.8276
>T289376 WP_234640265.1 NZ_LR813084:c872514-872134 [Delftia tsuruhatensis]
MNPVLVDTSVWIDHFRQGNPHLAQLLQQDMALMHPLVLGELACGTPPARARTLADLQRLKPARQASMREVLALIEREQLF
GLGCGLVDITLLASALMSSGASLWSRDKRLHALAQRFGIACRSVLP
MNPVLVDTSVWIDHFRQGNPHLAQLLQQDMALMHPLVLGELACGTPPARARTLADLQRLKPARQASMREVLALIEREQLF
GLGCGLVDITLLASALMSSGASLWSRDKRLHALAQRFGIACRSVLP
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|