Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 110431..111073 | Replicon | chromosome |
| Accession | NZ_LR813084 | ||
| Organism | Delftia tsuruhatensis isolate BB1455 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | L1Z78_RS00495 | Protein ID | WP_234639636.1 |
| Coordinates | 110431..110853 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | L1Z78_RS00500 | Protein ID | WP_234639637.1 |
| Coordinates | 110840..111073 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L1Z78_RS00470 (TML_00093) | 106558..107571 | + | 1014 | WP_234639631.1 | acyl-CoA dehydrogenase family protein | - |
| L1Z78_RS00475 (TML_00094) | 107584..108372 | + | 789 | WP_234639632.1 | crotonase/enoyl-CoA hydratase family protein | - |
| L1Z78_RS00480 (TML_00095) | 108528..109268 | + | 741 | WP_234639633.1 | septum site-determining protein MinC | - |
| L1Z78_RS00485 (TML_00096) | 109318..110133 | + | 816 | WP_234639634.1 | septum site-determining protein MinD | - |
| L1Z78_RS00490 (TML_00097) | 110140..110403 | + | 264 | WP_234639635.1 | cell division topological specificity factor MinE | - |
| L1Z78_RS00495 (TML_00098) | 110431..110853 | - | 423 | WP_234639636.1 | PIN domain-containing protein | Toxin |
| L1Z78_RS00500 (TML_00099) | 110840..111073 | - | 234 | WP_234639637.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| L1Z78_RS00505 (TML_00100) | 111152..111673 | - | 522 | WP_234639638.1 | flavin reductase family protein | - |
| L1Z78_RS00510 (TML_00101) | 111820..112455 | - | 636 | WP_234639639.1 | 3'-5' exonuclease | - |
| L1Z78_RS00515 (TML_00102) | 112500..112988 | - | 489 | WP_234639640.1 | homoprotocatechuate degradation operon regulator HpaR | - |
| L1Z78_RS00520 (TML_00103) | 113063..113884 | - | 822 | WP_234639641.1 | aldolase/citrate lyase family protein | - |
| L1Z78_RS00525 (TML_00104) | 113902..115356 | - | 1455 | WP_234639642.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15013.23 Da Isoelectric Point: 5.9613
>T289375 WP_234639636.1 NZ_LR813084:c110853-110431 [Delftia tsuruhatensis]
MQEIEARAGASFLDSNVVLYLLSAESAKAGSAEALLKTGPVISVQVLNEVTHVCIRKLHMGWNDVEQFLALVRSFCRVVP
LTEDIHDLARQIAPRNGLSFYDACIVAAATASGCTTLHSEDMNHGQAIGSLTLCNPFKAA
MQEIEARAGASFLDSNVVLYLLSAESAKAGSAEALLKTGPVISVQVLNEVTHVCIRKLHMGWNDVEQFLALVRSFCRVVP
LTEDIHDLARQIAPRNGLSFYDACIVAAATASGCTTLHSEDMNHGQAIGSLTLCNPFKAA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|