Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 2519933..2520518 | Replicon | chromosome |
Accession | NZ_LR796240 | ||
Organism | Treponema socranskii subsp. buccale strain Marseille-CSURQ0203 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | H1X50_RS11435 | Protein ID | WP_180487323.1 |
Coordinates | 2520210..2520518 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | U1F7W0 |
Locus tag | H1X50_RS11430 | Protein ID | WP_021330949.1 |
Coordinates | 2519933..2520226 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1X50_RS11415 | 2515344..2516546 | - | 1203 | WP_180487321.1 | dicarboxylate/amino acid:cation symporter | - |
H1X50_RS11420 | 2517092..2519482 | + | 2391 | WP_180487322.1 | MMPL family transporter | - |
H1X50_RS11425 | 2519625..2519912 | + | 288 | WP_197927145.1 | HigA family addiction module antidote protein | - |
H1X50_RS11430 | 2519933..2520226 | - | 294 | WP_021330949.1 | putative addiction module antidote protein | Antitoxin |
H1X50_RS11435 | 2520210..2520518 | - | 309 | WP_180487323.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
H1X50_RS11440 | 2520683..2520976 | - | 294 | WP_180487324.1 | putative addiction module antidote protein | - |
H1X50_RS11445 | 2520978..2521289 | - | 312 | WP_197927116.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
H1X50_RS11450 | 2521437..2521850 | - | 414 | WP_180487326.1 | hypothetical protein | - |
H1X50_RS11455 | 2521913..2524270 | - | 2358 | WP_180487327.1 | MMPL family transporter | - |
H1X50_RS11460 | 2524242..2524871 | - | 630 | WP_180487328.1 | outer membrane lipoprotein carrier protein LolA | - |
H1X50_RS11465 | 2524904..2525329 | - | 426 | WP_180487329.1 | acyl-CoA thioesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11441.22 Da Isoelectric Point: 10.3602
>T289373 WP_180487323.1 NZ_LR796240:c2520518-2520210 [Treponema socranskii subsp. buccale]
VYKVLQTETYKKWFKKLRDERAKFAIGQRIARMTVGNFGDSKTVGGGVFELRIDVGKGYRVYFTNNGKQIVILLVGGDKS
TQDEDIKTAKKMAGGIDYGKID
VYKVLQTETYKKWFKKLRDERAKFAIGQRIARMTVGNFGDSKTVGGGVFELRIDVGKGYRVYFTNNGKQIVILLVGGDKS
TQDEDIKTAKKMAGGIDYGKID
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|