Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 971233..971798 | Replicon | chromosome |
| Accession | NZ_LR796240 | ||
| Organism | Treponema socranskii subsp. buccale strain Marseille-CSURQ0203 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | H1X50_RS04415 | Protein ID | WP_180485974.1 |
| Coordinates | 971233..971571 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S3K291 |
| Locus tag | H1X50_RS04420 | Protein ID | WP_016524650.1 |
| Coordinates | 971565..971798 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1X50_RS04390 | 966305..966754 | - | 450 | WP_180485969.1 | MarR family transcriptional regulator | - |
| H1X50_RS04395 | 966793..967578 | + | 786 | WP_180485970.1 | hypothetical protein | - |
| H1X50_RS04400 | 967712..969505 | - | 1794 | WP_180485971.1 | pyruvate kinase | - |
| H1X50_RS04405 | 969572..970567 | - | 996 | WP_180485972.1 | hypothetical protein | - |
| H1X50_RS04410 | 970594..971127 | - | 534 | WP_180485973.1 | hypothetical protein | - |
| H1X50_RS04415 | 971233..971571 | - | 339 | WP_180485974.1 | endoribonuclease MazF | Toxin |
| H1X50_RS04420 | 971565..971798 | - | 234 | WP_016524650.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| H1X50_RS04425 | 972465..974219 | - | 1755 | WP_180485975.1 | AIPR family protein | - |
| H1X50_RS04430 | 974329..974721 | - | 393 | WP_180485976.1 | hypothetical protein | - |
| H1X50_RS04435 | 974783..975679 | - | 897 | WP_180485977.1 | hypothetical protein | - |
| H1X50_RS04440 | 975789..976085 | - | 297 | WP_180485978.1 | Txe/YoeB family addiction module toxin | - |
| H1X50_RS04445 | 976086..976337 | - | 252 | WP_180485979.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| H1X50_RS04450 | 976427..976660 | - | 234 | WP_180485980.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 970594..988959 | 18365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12819.64 Da Isoelectric Point: 6.4459
>T289372 WP_180485974.1 NZ_LR796240:c971571-971233 [Treponema socranskii subsp. buccale]
MVNSNYVPDRGDLVWLDFNPQAGYEQKGRRPAICISQKRYNQKAGLALFCPITSHIKGYPFEIVLDNHSINGCILSDQVK
NLDYKKRSCDFIEKTTEEEINAVVDNIKLLIE
MVNSNYVPDRGDLVWLDFNPQAGYEQKGRRPAICISQKRYNQKAGLALFCPITSHIKGYPFEIVLDNHSINGCILSDQVK
NLDYKKRSCDFIEKTTEEEINAVVDNIKLLIE
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|