Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 971233..971798 Replicon chromosome
Accession NZ_LR796240
Organism Treponema socranskii subsp. buccale strain Marseille-CSURQ0203

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag H1X50_RS04415 Protein ID WP_180485974.1
Coordinates 971233..971571 (-) Length 113 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID S3K291
Locus tag H1X50_RS04420 Protein ID WP_016524650.1
Coordinates 971565..971798 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1X50_RS04390 966305..966754 - 450 WP_180485969.1 MarR family transcriptional regulator -
H1X50_RS04395 966793..967578 + 786 WP_180485970.1 hypothetical protein -
H1X50_RS04400 967712..969505 - 1794 WP_180485971.1 pyruvate kinase -
H1X50_RS04405 969572..970567 - 996 WP_180485972.1 hypothetical protein -
H1X50_RS04410 970594..971127 - 534 WP_180485973.1 hypothetical protein -
H1X50_RS04415 971233..971571 - 339 WP_180485974.1 endoribonuclease MazF Toxin
H1X50_RS04420 971565..971798 - 234 WP_016524650.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
H1X50_RS04425 972465..974219 - 1755 WP_180485975.1 AIPR family protein -
H1X50_RS04430 974329..974721 - 393 WP_180485976.1 hypothetical protein -
H1X50_RS04435 974783..975679 - 897 WP_180485977.1 hypothetical protein -
H1X50_RS04440 975789..976085 - 297 WP_180485978.1 Txe/YoeB family addiction module toxin -
H1X50_RS04445 976086..976337 - 252 WP_180485979.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
H1X50_RS04450 976427..976660 - 234 WP_180485980.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 970594..988959 18365


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-110)

Antitoxin

SpoVT-AbrB domain

(6-47)


Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 12819.64 Da        Isoelectric Point: 6.4459

>T289372 WP_180485974.1 NZ_LR796240:c971571-971233 [Treponema socranskii subsp. buccale]
MVNSNYVPDRGDLVWLDFNPQAGYEQKGRRPAICISQKRYNQKAGLALFCPITSHIKGYPFEIVLDNHSINGCILSDQVK
NLDYKKRSCDFIEKTTEEEINAVVDNIKLLIE

Download         Length: 339 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8645.91 Da        Isoelectric Point: 5.7833

>AT289372 WP_016524650.1 NZ_LR796240:c971798-971565 [Treponema socranskii subsp. buccale]
MQVVVQKWGNSLGFRIPSLWAKDNNVKNGSKIEVLAEKGKIVILPQKKTLDDMLAMVTSENVHSEISTDYSVGNEEW

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB S3K291

References