Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
Location | 3184402..3185093 | Replicon | chromosome |
Accession | NZ_LR792684 | ||
Organism | Kyrpidia spormannii isolate FAVT5 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | HKD36_RS15540 | Protein ID | WP_170099945.1 |
Coordinates | 3184656..3185093 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | HKD36_RS15535 | Protein ID | WP_170099944.1 |
Coordinates | 3184402..3184659 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HKD36_RS15500 | 3180383..3180808 | - | 426 | WP_170099940.1 | putative toxin-antitoxin system toxin component, PIN family | - |
HKD36_RS15505 | 3180805..3181050 | - | 246 | WP_170099941.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HKD36_RS15510 | 3181131..3181368 | + | 238 | Protein_3036 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
HKD36_RS15515 | 3181365..3181514 | + | 150 | Protein_3037 | PIN domain-containing protein | - |
HKD36_RS15520 | 3181596..3182138 | - | 543 | WP_170099942.1 | ImmA/IrrE family metallo-endopeptidase | - |
HKD36_RS15525 | 3182305..3183644 | - | 1340 | Protein_3039 | transposase | - |
HKD36_RS15530 | 3183797..3184174 | - | 378 | WP_170099943.1 | hypothetical protein | - |
HKD36_RS15535 | 3184402..3184659 | + | 258 | WP_170099944.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
HKD36_RS15540 | 3184656..3185093 | + | 438 | WP_170099945.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
HKD36_RS15545 | 3186088..3186612 | - | 525 | WP_170099946.1 | Uma2 family endonuclease | - |
HKD36_RS15550 | 3186643..3186852 | - | 210 | WP_197945651.1 | hypothetical protein | - |
HKD36_RS15555 | 3186955..3187290 | - | 336 | WP_170086642.1 | hypothetical protein | - |
HKD36_RS15560 | 3187283..3187849 | - | 567 | WP_170086771.1 | IS630 family transposase | - |
HKD36_RS15565 | 3187797..3188342 | - | 546 | WP_170099947.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 16405.82 Da Isoelectric Point: 7.1376
>T289371 WP_170099945.1 NZ_LR792684:3184656-3185093 [Kyrpidia spormannii]
VKYLLDTCVISELVKRAPAPAVLRWVENQDEENLYLSVLTLGELQRGVSKLLDRSRAEQLQAWLNDDLTHRFQRRILPVD
QKVAKAWGEISGDAARRGETLPVMDSLIAATAQVHGLVVVTRNVRDIERCRVPVTNPWPDTRADL
VKYLLDTCVISELVKRAPAPAVLRWVENQDEENLYLSVLTLGELQRGVSKLLDRSRAEQLQAWLNDDLTHRFQRRILPVD
QKVAKAWGEISGDAARRGETLPVMDSLIAATAQVHGLVVVTRNVRDIERCRVPVTNPWPDTRADL
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|