Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-PHD |
| Location | 375875..376494 | Replicon | chromosome |
| Accession | NZ_LR792684 | ||
| Organism | Kyrpidia spormannii isolate FAVT5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | HKD36_RS01970 | Protein ID | WP_170084800.1 |
| Coordinates | 376108..376494 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | D5WW04 |
| Locus tag | HKD36_RS01965 | Protein ID | WP_013074928.1 |
| Coordinates | 375875..376111 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HKD36_RS01945 | 370875..371045 | + | 171 | WP_170086744.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| HKD36_RS01955 | 372773..373930 | + | 1158 | Protein_379 | transposase | - |
| HKD36_RS01960 | 374331..375628 | + | 1298 | Protein_380 | transposase | - |
| HKD36_RS01965 | 375875..376111 | + | 237 | WP_013074928.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| HKD36_RS01970 | 376108..376494 | + | 387 | WP_170084800.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| HKD36_RS01975 | 376889..377899 | - | 1011 | WP_170084801.1 | GTP-binding protein | - |
| HKD36_RS01980 | 377913..378251 | - | 339 | WP_170084802.1 | hypothetical protein | - |
| HKD36_RS01985 | 378331..379215 | - | 885 | WP_170084803.1 | polysaccharide deacetylase | - |
| HKD36_RS01990 | 379240..380205 | - | 966 | WP_170100012.1 | asparaginase | - |
| HKD36_RS01995 | 380312..381460 | - | 1149 | WP_170099039.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14884.15 Da Isoelectric Point: 4.7434
>T289370 WP_170084800.1 NZ_LR792684:376108-376494 [Kyrpidia spormannii]
MKTLLDTHVFLWWITDDGRMSKRARAIIQDTRNELYLSAASAWEIAIKAALGRIRVYEDLDRFMTQQMNENGIVDLPVEI
LHALGVYGLPDLHRDPFDRLLVAQAIQEGMPIITADEWIKRYDVETIW
MKTLLDTHVFLWWITDDGRMSKRARAIIQDTRNELYLSAASAWEIAIKAALGRIRVYEDLDRFMTQQMNENGIVDLPVEI
LHALGVYGLPDLHRDPFDRLLVAQAIQEGMPIITADEWIKRYDVETIW
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|