Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-Phd
Location 3182331..3183016 Replicon chromosome
Accession NZ_LR792683
Organism Kyrpidia spormannii isolate COOX1

Toxin (Protein)


Gene name vapC Uniprot ID D5WX22
Locus tag COOX1_RS15525 Protein ID WP_013077082.1
Coordinates 3182579..3183016 (+) Length 146 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag COOX1_RS15520 Protein ID WP_170086639.1
Coordinates 3182331..3182582 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
COOX1_RS15480 3177631..3177933 + 303 WP_170086635.1 hypothetical protein -
COOX1_RS15485 3178302..3178727 - 426 WP_170086636.1 putative toxin-antitoxin system toxin component, PIN family -
COOX1_RS15490 3178724..3179014 - 291 WP_170086637.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
COOX1_RS15495 3179013..3179289 + 277 Protein_3024 type II toxin-antitoxin system Phd/YefM family antitoxin -
COOX1_RS15500 3179286..3179435 + 150 Protein_3025 PIN domain-containing protein -
COOX1_RS15505 3179517..3180068 - 552 WP_170086961.1 ImmA/IrrE family metallo-endopeptidase -
COOX1_RS15510 3180228..3181567 - 1340 Protein_3027 transposase -
COOX1_RS15515 3181720..3182097 - 378 WP_170086638.1 hypothetical protein -
COOX1_RS15520 3182331..3182582 + 252 WP_170086639.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
COOX1_RS15525 3182579..3183016 + 438 WP_013077082.1 type II toxin-antitoxin system VapC family toxin Toxin
COOX1_RS15530 3184012..3184536 - 525 WP_170086640.1 Uma2 family endonuclease -
COOX1_RS15535 3184567..3184800 - 234 WP_170086641.1 hypothetical protein -
COOX1_RS15540 3184848..3185183 - 336 WP_170086642.1 hypothetical protein -
COOX1_RS15545 3185176..3185742 - 567 WP_170086962.1 IS630 family transposase -
COOX1_RS15550 3185690..3186235 - 546 WP_170085301.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-65)


Sequences

Toxin        


Download         Length: 146 a.a.        Molecular weight: 16377.81 Da        Isoelectric Point: 7.1375

>T289368 WP_013077082.1 NZ_LR792683:3182579-3183016 [Kyrpidia spormannii]
VKYLLDTCVISELVKKAPAPAVLRWVENQDEENLYLSVLTLGELQRGVSKLLDRSRAEQLQAWLNDDLTHRFQRRILPVD
QKVAKAWGEISGDAARRGETLPVMDSLIAATAQVHGLVVVTRNVRDIERCRVPVTNPWPDTRADL

Download         Length: 438 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9465.93 Da        Isoelectric Point: 9.9218

>AT289368 WP_170086639.1 NZ_LR792683:3182331-3182582 [Kyrpidia spormannii]
MDKTWQLQDAKNRLSELVNKAMRNGPQMITVRGKPAVVVVSVQEYERLAHPKASLVEFFRNSPLVGVELDVERLRDHPRE
AGL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6F9EII2

Antitoxin

Source ID Structure

References