Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-Phd |
| Location | 3182331..3183016 | Replicon | chromosome |
| Accession | NZ_LR792683 | ||
| Organism | Kyrpidia spormannii isolate COOX1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | D5WX22 |
| Locus tag | COOX1_RS15525 | Protein ID | WP_013077082.1 |
| Coordinates | 3182579..3183016 (+) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | COOX1_RS15520 | Protein ID | WP_170086639.1 |
| Coordinates | 3182331..3182582 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| COOX1_RS15480 | 3177631..3177933 | + | 303 | WP_170086635.1 | hypothetical protein | - |
| COOX1_RS15485 | 3178302..3178727 | - | 426 | WP_170086636.1 | putative toxin-antitoxin system toxin component, PIN family | - |
| COOX1_RS15490 | 3178724..3179014 | - | 291 | WP_170086637.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| COOX1_RS15495 | 3179013..3179289 | + | 277 | Protein_3024 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| COOX1_RS15500 | 3179286..3179435 | + | 150 | Protein_3025 | PIN domain-containing protein | - |
| COOX1_RS15505 | 3179517..3180068 | - | 552 | WP_170086961.1 | ImmA/IrrE family metallo-endopeptidase | - |
| COOX1_RS15510 | 3180228..3181567 | - | 1340 | Protein_3027 | transposase | - |
| COOX1_RS15515 | 3181720..3182097 | - | 378 | WP_170086638.1 | hypothetical protein | - |
| COOX1_RS15520 | 3182331..3182582 | + | 252 | WP_170086639.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| COOX1_RS15525 | 3182579..3183016 | + | 438 | WP_013077082.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| COOX1_RS15530 | 3184012..3184536 | - | 525 | WP_170086640.1 | Uma2 family endonuclease | - |
| COOX1_RS15535 | 3184567..3184800 | - | 234 | WP_170086641.1 | hypothetical protein | - |
| COOX1_RS15540 | 3184848..3185183 | - | 336 | WP_170086642.1 | hypothetical protein | - |
| COOX1_RS15545 | 3185176..3185742 | - | 567 | WP_170086962.1 | IS630 family transposase | - |
| COOX1_RS15550 | 3185690..3186235 | - | 546 | WP_170085301.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 16377.81 Da Isoelectric Point: 7.1375
>T289368 WP_013077082.1 NZ_LR792683:3182579-3183016 [Kyrpidia spormannii]
VKYLLDTCVISELVKKAPAPAVLRWVENQDEENLYLSVLTLGELQRGVSKLLDRSRAEQLQAWLNDDLTHRFQRRILPVD
QKVAKAWGEISGDAARRGETLPVMDSLIAATAQVHGLVVVTRNVRDIERCRVPVTNPWPDTRADL
VKYLLDTCVISELVKKAPAPAVLRWVENQDEENLYLSVLTLGELQRGVSKLLDRSRAEQLQAWLNDDLTHRFQRRILPVD
QKVAKAWGEISGDAARRGETLPVMDSLIAATAQVHGLVVVTRNVRDIERCRVPVTNPWPDTRADL
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|