Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 375472..376091 | Replicon | chromosome |
Accession | NZ_LR792683 | ||
Organism | Kyrpidia spormannii isolate COOX1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | COOX1_RS01965 | Protein ID | WP_170084800.1 |
Coordinates | 375705..376091 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | D5WW04 |
Locus tag | COOX1_RS01960 | Protein ID | WP_013074928.1 |
Coordinates | 375472..375708 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
COOX1_RS01940 | 370528..370698 | + | 171 | WP_170086744.1 | type II toxin-antitoxin system HicB family antitoxin | - |
COOX1_RS01950 | 372426..373583 | + | 1158 | Protein_375 | transposase | - |
COOX1_RS01955 | 373984..375225 | + | 1242 | WP_170084799.1 | transposase | - |
COOX1_RS01960 | 375472..375708 | + | 237 | WP_013074928.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
COOX1_RS01965 | 375705..376091 | + | 387 | WP_170084800.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
COOX1_RS01970 | 376486..377496 | - | 1011 | WP_170084801.1 | GTP-binding protein | - |
COOX1_RS01975 | 377510..377848 | - | 339 | WP_170084802.1 | hypothetical protein | - |
COOX1_RS01980 | 377928..378812 | - | 885 | WP_170084803.1 | polysaccharide deacetylase | - |
COOX1_RS01985 | 378837..379802 | - | 966 | WP_170084804.1 | asparaginase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14884.15 Da Isoelectric Point: 4.7434
>T289367 WP_170084800.1 NZ_LR792683:375705-376091 [Kyrpidia spormannii]
MKTLLDTHVFLWWITDDGRMSKRARAIIQDTRNELYLSAASAWEIAIKAALGRIRVYEDLDRFMTQQMNENGIVDLPVEI
LHALGVYGLPDLHRDPFDRLLVAQAIQEGMPIITADEWIKRYDVETIW
MKTLLDTHVFLWWITDDGRMSKRARAIIQDTRNELYLSAASAWEIAIKAALGRIRVYEDLDRFMTQQMNENGIVDLPVEI
LHALGVYGLPDLHRDPFDRLLVAQAIQEGMPIITADEWIKRYDVETIW
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|