Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 199615..200268 | Replicon | chromosome |
Accession | NZ_LR792683 | ||
Organism | Kyrpidia spormannii isolate COOX1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | D5WSA7 |
Locus tag | COOX1_RS01120 | Protein ID | WP_013074285.1 |
Coordinates | 199918..200268 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2K8N2G8 |
Locus tag | COOX1_RS01115 | Protein ID | WP_041303528.1 |
Coordinates | 199615..199914 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
COOX1_RS01095 | 194902..195294 | + | 393 | WP_170086728.1 | holo-ACP synthase | - |
COOX1_RS01100 | 195426..196937 | + | 1512 | WP_170084684.1 | NAD(P)H-hydrate dehydratase | - |
COOX1_RS01105 | 197018..198010 | + | 993 | WP_170084685.1 | outer membrane lipoprotein carrier protein LolA | - |
COOX1_RS01110 | 198021..199112 | - | 1092 | WP_170084686.1 | cation diffusion facilitator family transporter | - |
COOX1_RS01115 | 199615..199914 | + | 300 | WP_041303528.1 | CopG family ribbon-helix-helix protein | Antitoxin |
COOX1_RS01120 | 199918..200268 | + | 351 | WP_013074285.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
COOX1_RS01125 | 200327..201586 | + | 1260 | WP_170084687.1 | adenosylhomocysteinase | - |
COOX1_RS01130 | 201742..202482 | + | 741 | WP_170084688.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
COOX1_RS01135 | 202774..202995 | + | 222 | WP_013074288.1 | DUF1659 domain-containing protein | - |
COOX1_RS01140 | 203031..203264 | + | 234 | WP_170084689.1 | DUF2922 domain-containing protein | - |
COOX1_RS01145 | 203381..203974 | - | 594 | WP_100666597.1 | DedA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12906.94 Da Isoelectric Point: 5.6976
>T289366 WP_013074285.1 NZ_LR792683:199918-200268 [Kyrpidia spormannii]
VNIKRGDIFFANLSPVVGSEQGGFRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGLDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMSKVNESLMISLGLIDF
VNIKRGDIFFANLSPVVGSEQGGFRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKTYGLDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMSKVNESLMISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8N5K4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2K8N2G8 |