Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 85560..86095 | Replicon | plasmid 1 |
| Accession | NZ_LR792630 | ||
| Organism | Klebsiella pneumoniae isolate SB5881 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | HU711_RS27645 | Protein ID | WP_016531292.1 |
| Coordinates | 85560..85847 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | W9BAK2 |
| Locus tag | HU711_RS27650 | Protein ID | WP_016531291.1 |
| Coordinates | 85844..86095 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HU711_RS27625 | 81359..82579 | - | 1221 | WP_032446666.1 | ISL3 family transposase | - |
| HU711_RS27630 | 82740..83216 | + | 477 | WP_016529487.1 | hypothetical protein | - |
| HU711_RS27635 | 83473..83760 | - | 288 | WP_016529486.1 | hypothetical protein | - |
| HU711_RS27640 | 83850..84512 | - | 663 | WP_016529485.1 | chromosome partitioning protein ParA | - |
| HU711_RS27645 | 85560..85847 | - | 288 | WP_016531292.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HU711_RS27650 | 85844..86095 | - | 252 | WP_016531291.1 | toxin-antitoxin stability system antitoxin protein StbD | Antitoxin |
| HU711_RS27655 | 86191..87462 | - | 1272 | WP_046041953.1 | Y-family DNA polymerase | - |
| HU711_RS27660 | 87462..87956 | - | 495 | WP_109234271.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| HU711_RS27665 | 87942..89021 | + | 1080 | WP_016531016.1 | IS481 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | clbI / basG | 1..95086 | 95086 | |
| - | flank | IS/Tn | - | - | 81359..82579 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11120.16 Da Isoelectric Point: 10.4373
>T289365 WP_016531292.1 NZ_LR792630:c85847-85560 [Klebsiella pneumoniae]
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
MTYTVKFREDALKEWNKLDKTIQQQFAKKLKKCCENPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDNQLIIAIVAVGK
RERSDVYTLASERMK
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|