Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 105805..106556 | Replicon | plasmid 2 |
| Accession | NZ_LR792629 | ||
| Organism | Klebsiella pneumoniae isolate SB5881 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | W9BA31 |
| Locus tag | HU711_RS26860 | Protein ID | WP_032104592.1 |
| Coordinates | 105805..106287 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | W9B1S8 |
| Locus tag | HU711_RS26865 | Protein ID | WP_016529519.1 |
| Coordinates | 106278..106556 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HU711_RS26825 | 100825..101268 | + | 444 | WP_016528982.1 | DUF2384 domain-containing protein | - |
| HU711_RS26830 | 101265..101735 | + | 471 | WP_016528981.1 | RES family NAD+ phosphorylase | - |
| HU711_RS26835 | 101846..102106 | - | 261 | WP_016528980.1 | hypothetical protein | - |
| HU711_RS26840 | 102506..103734 | + | 1229 | WP_115217266.1 | IS3 family transposase | - |
| HU711_RS26845 | 104119..104355 | + | 237 | WP_016529523.1 | hypothetical protein | - |
| HU711_RS26850 | 104421..105026 | - | 606 | Protein_110 | GIY-YIG nuclease family protein | - |
| HU711_RS26855 | 105363..105767 | - | 405 | WP_016529521.1 | DUF2251 domain-containing protein | - |
| HU711_RS26860 | 105805..106287 | - | 483 | WP_032104592.1 | GNAT family N-acetyltransferase | Toxin |
| HU711_RS26865 | 106278..106556 | - | 279 | WP_016529519.1 | DUF1778 domain-containing protein | Antitoxin |
| HU711_RS26870 | 106864..107400 | + | 537 | WP_032445791.1 | hypothetical protein | - |
| HU711_RS26875 | 107784..108794 | - | 1011 | WP_004152284.1 | zinc-binding alcohol dehydrogenase family protein | - |
| HU711_RS26880 | 109255..110337 | + | 1083 | WP_016528990.1 | DNA-binding transcriptional repressor LacI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..160760 | 160760 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17781.73 Da Isoelectric Point: 9.4946
>T289363 WP_032104592.1 NZ_LR792629:c106287-105805 [Klebsiella pneumoniae]
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRPPEPLTPEHNIAEFCCQDQVLSEWLKKKALKNHRTGISRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTEHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|