Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 100825..101735 Replicon plasmid 2
Accession NZ_LR792629
Organism Klebsiella pneumoniae isolate SB5881

Toxin (Protein)


Gene name - Uniprot ID W9B9V2
Locus tag HU711_RS26830 Protein ID WP_016528981.1
Coordinates 101265..101735 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID W9B1L8
Locus tag HU711_RS26825 Protein ID WP_016528982.1
Coordinates 100825..101268 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HU711_RS26795 95846..96367 + 522 WP_004213635.1 sigma-70 family RNA polymerase sigma factor -
HU711_RS26800 96364..97317 + 954 Protein_100 fec operon regulator FecR -
HU711_RS26805 97404..99530 + 2127 WP_032105434.1 TonB-dependent receptor family protein -
HU711_RS26810 99605..99760 + 156 WP_016528985.1 hypothetical protein -
HU711_RS26815 99905..100126 + 222 WP_016528984.1 DUF2188 domain-containing protein -
HU711_RS26820 100235..100724 + 490 Protein_104 DUF4113 domain-containing protein -
HU711_RS26825 100825..101268 + 444 WP_016528982.1 DUF2384 domain-containing protein Antitoxin
HU711_RS26830 101265..101735 + 471 WP_016528981.1 RES family NAD+ phosphorylase Toxin
HU711_RS26835 101846..102106 - 261 WP_016528980.1 hypothetical protein -
HU711_RS26840 102506..103734 + 1229 WP_115217266.1 IS3 family transposase -
HU711_RS26845 104119..104355 + 237 WP_016529523.1 hypothetical protein -
HU711_RS26850 104421..105026 - 606 Protein_110 GIY-YIG nuclease family protein -
HU711_RS26855 105363..105767 - 405 WP_016529521.1 DUF2251 domain-containing protein -
HU711_RS26860 105805..106287 - 483 WP_032104592.1 GNAT family N-acetyltransferase -
HU711_RS26865 106278..106556 - 279 WP_016529519.1 DUF1778 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA 1..160760 160760


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre/MbcA/ParS-like, toxin-binding domain

(94-144)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17603.85 Da        Isoelectric Point: 4.4093

>T289362 WP_016528981.1 NZ_LR792629:101265-101735 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPDNWADEDAPQELADYGDAWSFTWSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16494.83 Da        Isoelectric Point: 10.2498

>AT289362 WP_016528982.1 NZ_LR792629:100825-101268 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEIIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W9B9V2

Antitoxin

Source ID Structure
AlphaFold DB W9B1L8

References