Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 927684..928341 | Replicon | chromosome |
| Accession | NZ_LR792628 | ||
| Organism | Klebsiella pneumoniae isolate SB5881 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | HU711_RS04590 | Protein ID | WP_002916310.1 |
| Coordinates | 927931..928341 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | HU711_RS04585 | Protein ID | WP_002916312.1 |
| Coordinates | 927684..927950 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HU711_RS04560 | 922892..924325 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| HU711_RS04565 | 924444..925172 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| HU711_RS04570 | 925222..925533 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| HU711_RS04575 | 925697..926356 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| HU711_RS04580 | 926455..927438 | - | 984 | WP_016530681.1 | tRNA-modifying protein YgfZ | - |
| HU711_RS04585 | 927684..927950 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| HU711_RS04590 | 927931..928341 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| HU711_RS04595 | 928348..928869 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
| HU711_RS04600 | 928970..929866 | + | 897 | WP_046042376.1 | site-specific tyrosine recombinase XerD | - |
| HU711_RS04605 | 929889..930602 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| HU711_RS04610 | 930608..932341 | + | 1734 | WP_016530103.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T289352 WP_002916310.1 NZ_LR792628:927931-928341 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |