Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4432517..4433112 | Replicon | chromosome |
| Accession | NZ_LR782232 | ||
| Organism | Escherichia coli isolate SC467 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | HV361_RS21060 | Protein ID | WP_000239579.1 |
| Coordinates | 4432517..4432867 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | U9Y2K1 |
| Locus tag | HV361_RS21065 | Protein ID | WP_001223208.1 |
| Coordinates | 4432861..4433112 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV361_RS21040 | 4427793..4428815 | - | 1023 | WP_032218943.1 | ABC transporter permease | - |
| HV361_RS21045 | 4428829..4430331 | - | 1503 | WP_000205791.1 | sugar ABC transporter ATP-binding protein | - |
| HV361_RS21050 | 4430641..4431597 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| HV361_RS21055 | 4431907..4432437 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| HV361_RS21060 | 4432517..4432867 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| HV361_RS21065 | 4432861..4433112 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| HV361_RS21070 | 4433324..4433665 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| HV361_RS21075 | 4433668..4437448 | - | 3781 | Protein_4115 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T289344 WP_000239579.1 NZ_LR782232:c4432867-4432517 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LQ26 |