Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1631259..1631884 | Replicon | chromosome |
| Accession | NZ_LR782232 | ||
| Organism | Escherichia coli isolate SC467 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | HV361_RS07745 | Protein ID | WP_000911330.1 |
| Coordinates | 1631486..1631884 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | HV361_RS07740 | Protein ID | WP_000450524.1 |
| Coordinates | 1631259..1631486 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV361_RS07715 | 1627061..1627531 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| HV361_RS07720 | 1627531..1628103 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| HV361_RS07725 | 1628249..1629127 | + | 879 | WP_001345767.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| HV361_RS07730 | 1629144..1630178 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| HV361_RS07735 | 1630391..1631104 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| HV361_RS07740 | 1631259..1631486 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| HV361_RS07745 | 1631486..1631884 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| HV361_RS07750 | 1632031..1632894 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| HV361_RS07755 | 1632909..1634925 | + | 2017 | Protein_1506 | tRNA cytosine(34) acetyltransferase TmcA | - |
| HV361_RS07760 | 1634999..1635697 | + | 699 | WP_000679812.1 | esterase | - |
| HV361_RS07765 | 1635807..1636007 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | aac(2')-IIa | algU | 1489268..1660079 | 170811 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289334 WP_000911330.1 NZ_LR782232:1631486-1631884 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|