Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1143266..1143920 | Replicon | chromosome |
Accession | NZ_LR782232 | ||
Organism | Escherichia coli isolate SC467 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | HV361_RS05460 | Protein ID | WP_000244772.1 |
Coordinates | 1143513..1143920 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | HV361_RS05455 | Protein ID | WP_000354046.1 |
Coordinates | 1143266..1143532 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HV361_RS05430 | 1138554..1139297 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
HV361_RS05435 | 1139354..1140787 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
HV361_RS05440 | 1140832..1141143 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
HV361_RS05445 | 1141307..1141966 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
HV361_RS05450 | 1142043..1143023 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
HV361_RS05455 | 1143266..1143532 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
HV361_RS05460 | 1143513..1143920 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
HV361_RS05465 | 1143960..1144481 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
HV361_RS05470 | 1144593..1145489 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
HV361_RS05475 | 1145514..1146224 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
HV361_RS05480 | 1146230..1147963 | + | 1734 | WP_000813223.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T289332 WP_000244772.1 NZ_LR782232:1143513-1143920 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |