Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 60579..61113 | Replicon | plasmid pI |
| Accession | NZ_LR778302 | ||
| Organism | Denitratisoma oestradiolicum strain DSM 16959 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | DENOEST_RS19460 | Protein ID | WP_183148372.1 |
| Coordinates | 60579..60860 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | DENOEST_RS19465 | Protein ID | WP_183148373.1 |
| Coordinates | 60847..61113 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DENOEST_RS19440 | 55820..56038 | + | 219 | WP_183148368.1 | hypothetical protein | - |
| DENOEST_RS19445 | 56070..56858 | - | 789 | WP_183148369.1 | phage Gp37/Gp68 family protein | - |
| DENOEST_RS19450 | 56858..57922 | - | 1065 | WP_183148370.1 | DNA-binding protein | - |
| DENOEST_RS19455 | 59480..60445 | - | 966 | WP_183148371.1 | replication initiator protein A | - |
| DENOEST_RS19460 | 60579..60860 | - | 282 | WP_183148372.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| DENOEST_RS19465 | 60847..61113 | - | 267 | WP_183148373.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| DENOEST_RS19470 | 61190..62830 | - | 1641 | WP_183148374.1 | hypothetical protein | - |
| DENOEST_RS19475 | 62903..63277 | - | 375 | WP_183148375.1 | hypothetical protein | - |
| DENOEST_RS19480 | 63359..64645 | - | 1287 | WP_183148376.1 | ParB/RepB/Spo0J family partition protein | - |
| DENOEST_RS19485 | 64658..65440 | - | 783 | WP_183148377.1 | ParA family protein | - |
| DENOEST_RS19490 | 65468..65887 | - | 420 | WP_183148378.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..124849 | 124849 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10697.26 Da Isoelectric Point: 9.5018
>T289328 WP_183148372.1 NZ_LR778302:c60860-60579 [Denitratisoma oestradiolicum]
MRTIDRSSAFKRDYKREAKGQHRATLDDALKPVLMALVTDQLLDARYRDHDLSGAWGGYRECHIKPDLLLIYRKLDGDVL
RLARLGSHSELFG
MRTIDRSSAFKRDYKREAKGQHRATLDDALKPVLMALVTDQLLDARYRDHDLSGAWGGYRECHIKPDLLLIYRKLDGDVL
RLARLGSHSELFG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|