Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 4015164..4015701 | Replicon | chromosome |
| Accession | NZ_LR778301 | ||
| Organism | Denitratisoma oestradiolicum strain DSM 16959 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | DENOEST_RS18360 | Protein ID | WP_145770370.1 |
| Coordinates | 4015420..4015701 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | DENOEST_RS18355 | Protein ID | WP_145770371.1 |
| Coordinates | 4015164..4015433 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DENOEST_RS18340 | 4010407..4011942 | - | 1536 | WP_145770373.1 | class I SAM-dependent methyltransferase | - |
| DENOEST_RS18345 | 4012113..4014758 | - | 2646 | WP_145770372.1 | calcium-binding protein | - |
| DENOEST_RS18350 | 4014825..4014920 | - | 96 | Protein_3619 | hypothetical protein | - |
| DENOEST_RS18355 | 4015164..4015433 | + | 270 | WP_145770371.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| DENOEST_RS18360 | 4015420..4015701 | + | 282 | WP_145770370.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| DENOEST_RS18365 | 4015818..4017020 | - | 1203 | WP_145770369.1 | site-specific integrase | - |
| DENOEST_RS18370 | 4017850..4018653 | + | 804 | WP_145770368.1 | hypothetical protein | - |
| DENOEST_RS18375 | 4018975..4019895 | - | 921 | WP_145770367.1 | replication protein C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10663.19 Da Isoelectric Point: 9.5732
>T289326 WP_145770370.1 NZ_LR778301:4015420-4015701 [Denitratisoma oestradiolicum]
MRTIERSSAFKRDYKRESKGAHRASLDTDLVHVLTALVHDKPLPAKLRDHDLSGDWAGYRECHIKPDLLLIYRKPDAETL
RLARLGSHSELFG
MRTIERSSAFKRDYKRESKGAHRASLDTDLVHVLTALVHDKPLPAKLRDHDLSGDWAGYRECHIKPDLLLIYRKPDAETL
RLARLGSHSELFG
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|