Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-couple_hipB |
Location | 74007..75526 | Replicon | chromosome |
Accession | NZ_LR778301 | ||
Organism | Denitratisoma oestradiolicum strain DSM 16959 |
Toxin (Protein)
Gene name | HipA1 | Uniprot ID | - |
Locus tag | DENOEST_RS00495 | Protein ID | WP_145770225.1 |
Coordinates | 74007..75284 (-) | Length | 426 a.a. |
Antitoxin (Protein)
Gene name | HipB1 | Uniprot ID | - |
Locus tag | DENOEST_RS00500 | Protein ID | WP_145770224.1 |
Coordinates | 75281..75526 (-) | Length | 82 a.a. |
Genomic Context
Location: 70870..71301 (432 bp)
Type: Others
Protein ID: WP_197970466.1
Type: Others
Protein ID: WP_197970466.1
Location: 71444..71656 (213 bp)
Type: Others
Protein ID: WP_145770230.1
Type: Others
Protein ID: WP_145770230.1
Location: 71696..72412 (717 bp)
Type: Others
Protein ID: WP_145770229.1
Type: Others
Protein ID: WP_145770229.1
Location: 72877..73002 (126 bp)
Type: Others
Protein ID: WP_197970467.1
Type: Others
Protein ID: WP_197970467.1
Location: 73146..73430 (285 bp)
Type: Others
Protein ID: WP_145770227.1
Type: Others
Protein ID: WP_145770227.1
Location: 73427..73780 (354 bp)
Type: Others
Protein ID: WP_145770226.1
Type: Others
Protein ID: WP_145770226.1
Location: 75895..76005 (111 bp)
Type: Others
Protein ID: WP_145770314.1
Type: Others
Protein ID: WP_145770314.1
Location: 76244..77077 (834 bp)
Type: Others
Protein ID: WP_145770223.1
Type: Others
Protein ID: WP_145770223.1
Location: 74007..75284 (1278 bp)
Type: Toxin
Protein ID: WP_145770225.1
Type: Toxin
Protein ID: WP_145770225.1
Location: 75281..75526 (246 bp)
Type: Antitoxin
Protein ID: WP_145770224.1
Type: Antitoxin
Protein ID: WP_145770224.1
Location: 77096..78940 (1845 bp)
Type: Others
Protein ID: WP_145770222.1
Type: Others
Protein ID: WP_145770222.1
Location: 79137..80084 (948 bp)
Type: Others
Protein ID: WP_145770221.1
Type: Others
Protein ID: WP_145770221.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DENOEST_RS00465 | 70870..71301 | + | 432 | WP_197970466.1 | class I SAM-dependent methyltransferase | - |
DENOEST_RS00470 | 71444..71656 | + | 213 | WP_145770230.1 | integrase | - |
DENOEST_RS00475 | 71696..72412 | + | 717 | WP_145770229.1 | transposase | - |
DENOEST_RS19860 | 72877..73002 | + | 126 | WP_197970467.1 | hypothetical protein | - |
DENOEST_RS00485 | 73146..73430 | + | 285 | WP_145770227.1 | hypothetical protein | - |
DENOEST_RS00490 | 73427..73780 | + | 354 | WP_145770226.1 | hypothetical protein | - |
DENOEST_RS00495 | 74007..75284 | - | 1278 | WP_145770225.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
DENOEST_RS00500 | 75281..75526 | - | 246 | WP_145770224.1 | helix-turn-helix transcriptional regulator | Antitoxin |
DENOEST_RS00505 | 75895..76005 | + | 111 | WP_145770314.1 | DUF4160 domain-containing protein | - |
DENOEST_RS00510 | 76244..77077 | + | 834 | WP_145770223.1 | methyltransferase domain-containing protein | - |
DENOEST_RS00515 | 77096..78940 | - | 1845 | WP_145770222.1 | DUF4214 domain-containing protein | - |
DENOEST_RS00520 | 79137..80084 | - | 948 | WP_145770221.1 | FAD-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 67691..82363 | 14672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 426 a.a. Molecular weight: 46781.52 Da Isoelectric Point: 8.0978
>T289324 WP_145770225.1 NZ_LR778301:c75284-74007 [Denitratisoma oestradiolicum]
MSRVLEVWLLGQHVGQLAQVDGRLNFSYSPQWLQSANARPLSHHLPLQAGSFDDKATRPFFAGLLPEGDKRRLIAQTLHV
SRHNDFALLDGIGGECAGAVSLLETGQQPDAIQSAPVVRWLDQSELVAILDELPRRPMLAGDQGLRLSLAGAQDKLPVTF
ADGRMGLPLQNTPSSHILKPAISRVEGSVFNEGFCLALAAQIKLSVARAAIHRVADREYLLVERYDRVRQPDGALQRLHQ
EDFCQALGVAPEYKYQNEGGPDLAQCFGLVRKATRPSAPHILRLLDYAIFNAMIGNHDAHAKNFSLIYTERGAALAPLYD
TLSTAVYANLTDKMAMKIGSKYKFTELQSRHWEQFAQAAGLSPAQVKKRVLAIARQLPHEAAALRSSFVTQGLDHDILGK
IVNLIERRCLLTSKRLETAGPGDDE
MSRVLEVWLLGQHVGQLAQVDGRLNFSYSPQWLQSANARPLSHHLPLQAGSFDDKATRPFFAGLLPEGDKRRLIAQTLHV
SRHNDFALLDGIGGECAGAVSLLETGQQPDAIQSAPVVRWLDQSELVAILDELPRRPMLAGDQGLRLSLAGAQDKLPVTF
ADGRMGLPLQNTPSSHILKPAISRVEGSVFNEGFCLALAAQIKLSVARAAIHRVADREYLLVERYDRVRQPDGALQRLHQ
EDFCQALGVAPEYKYQNEGGPDLAQCFGLVRKATRPSAPHILRLLDYAIFNAMIGNHDAHAKNFSLIYTERGAALAPLYD
TLSTAVYANLTDKMAMKIGSKYKFTELQSRHWEQFAQAAGLSPAQVKKRVLAIARQLPHEAAALRSSFVTQGLDHDILGK
IVNLIERRCLLTSKRLETAGPGDDE
Download Length: 1278 bp