Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3806179..3807016 | Replicon | chromosome |
Accession | NZ_LR778153 | ||
Organism | Escherichia coli isolate SC480 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | H1C95_RS18390 | Protein ID | WP_000227784.1 |
Coordinates | 3806474..3807016 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | H1C95_RS18385 | Protein ID | WP_001297137.1 |
Coordinates | 3806179..3806490 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C95_RS18360 | 3801199..3802146 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
H1C95_RS18365 | 3802168..3804159 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
H1C95_RS18370 | 3804149..3804763 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
H1C95_RS18375 | 3804763..3805092 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
H1C95_RS18380 | 3805104..3805994 | + | 891 | WP_000971336.1 | heme o synthase | - |
H1C95_RS18385 | 3806179..3806490 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
H1C95_RS18390 | 3806474..3807016 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
H1C95_RS18395 | 3807072..3808007 | - | 936 | WP_001368479.1 | sel1 repeat family protein | - |
H1C95_RS18400 | 3808415..3809779 | + | 1365 | WP_001000978.1 | MFS transporter | - |
H1C95_RS18405 | 3809907..3810398 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
H1C95_RS18410 | 3810566..3811477 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T289317 WP_000227784.1 NZ_LR778153:3806474-3807016 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|