Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1582281..1582906 | Replicon | chromosome |
Accession | NZ_LR778153 | ||
Organism | Escherichia coli isolate SC480 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | H1C95_RS07595 | Protein ID | WP_000911330.1 |
Coordinates | 1582508..1582906 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | H1C95_RS07590 | Protein ID | WP_000450524.1 |
Coordinates | 1582281..1582508 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C95_RS07565 | 1578084..1578554 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
H1C95_RS07570 | 1578554..1579126 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
H1C95_RS07575 | 1579272..1580150 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
H1C95_RS07580 | 1580167..1581201 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
H1C95_RS07585 | 1581414..1582127 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
H1C95_RS07590 | 1582281..1582508 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
H1C95_RS07595 | 1582508..1582906 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
H1C95_RS07600 | 1583053..1583916 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
H1C95_RS07605 | 1583931..1585946 | + | 2016 | WP_000829355.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
H1C95_RS07610 | 1586020..1586718 | + | 699 | WP_000679823.1 | esterase | - |
H1C95_RS07615 | 1586828..1587028 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289310 WP_000911330.1 NZ_LR778153:1582508-1582906 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|