Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1146895..1147549 | Replicon | chromosome |
| Accession | NZ_LR778153 | ||
| Organism | Escherichia coli isolate SC480 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | H1C95_RS05525 | Protein ID | WP_000244772.1 |
| Coordinates | 1147142..1147549 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | H1C95_RS05520 | Protein ID | WP_000354046.1 |
| Coordinates | 1146895..1147161 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C95_RS05495 | 1142183..1142926 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
| H1C95_RS05500 | 1142983..1144416 | - | 1434 | WP_001387034.1 | 6-phospho-beta-glucosidase BglA | - |
| H1C95_RS05505 | 1144461..1144772 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| H1C95_RS05510 | 1144936..1145595 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| H1C95_RS05515 | 1145672..1146652 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| H1C95_RS05520 | 1146895..1147161 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| H1C95_RS05525 | 1147142..1147549 | + | 408 | WP_000244772.1 | protein YgfX | Toxin |
| H1C95_RS05530 | 1147589..1148110 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| H1C95_RS05535 | 1148222..1149118 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| H1C95_RS05540 | 1149143..1149853 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| H1C95_RS05545 | 1149859..1151592 | + | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T289308 WP_000244772.1 NZ_LR778153:1147142-1147549 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |