Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 584433..585233 | Replicon | chromosome |
Accession | NZ_LR778153 | ||
Organism | Escherichia coli isolate SC480 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4NNI0 |
Locus tag | H1C95_RS02695 | Protein ID | WP_000342449.1 |
Coordinates | 584706..585233 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | H1C95_RS02690 | Protein ID | WP_001277108.1 |
Coordinates | 584433..584699 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C95_RS02670 | 580091..580759 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
H1C95_RS02675 | 580752..581810 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
H1C95_RS02680 | 582055..582909 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
H1C95_RS02685 | 583180..584283 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
H1C95_RS02690 | 584433..584699 | + | 267 | WP_001277108.1 | DUF1778 domain-containing protein | Antitoxin |
H1C95_RS02695 | 584706..585233 | + | 528 | WP_000342449.1 | GNAT family N-acetyltransferase | Toxin |
H1C95_RS02700 | 585230..585613 | - | 384 | WP_000778781.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
H1C95_RS02705 | 586037..587146 | + | 1110 | WP_001352761.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
H1C95_RS02710 | 587194..588120 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
H1C95_RS02715 | 588117..589394 | + | 1278 | WP_000803798.1 | branched chain amino acid ABC transporter permease LivM | - |
H1C95_RS02720 | 589391..590158 | + | 768 | WP_000082110.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T289306 WP_000342449.1 NZ_LR778153:584706-585233 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6GTS | |
PDB | 6AJN | |
PDB | 6GTQ | |
PDB | 6GTO | |
PDB | 6GTR | |
PDB | 6AJM | |
AlphaFold DB | A0A829CN24 |