Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3800511..3801106 Replicon chromosome
Accession NZ_LR778152
Organism Escherichia coli isolate SC477

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag H1D09_RS18355 Protein ID WP_175058671.1
Coordinates 3800729..3801106 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag H1D09_RS18350 Protein ID WP_000557315.1
Coordinates 3800511..3800732 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D09_RS18325 3795587..3796696 + 1110 WP_001316697.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
H1D09_RS18330 3796744..3797670 + 927 WP_001295097.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
H1D09_RS18335 3797667..3798944 + 1278 WP_000803817.1 branched chain amino acid ABC transporter permease LivM -
H1D09_RS18340 3798941..3799708 + 768 WP_033811128.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
H1D09_RS18345 3799710..3800423 + 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
H1D09_RS18350 3800511..3800732 + 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
H1D09_RS18355 3800729..3801106 + 378 WP_175058671.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
H1D09_RS18360 3801315..3802631 + 1317 WP_021531661.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
H1D09_RS18365 3802729..3803617 + 889 Protein_3583 sn-glycerol-3-phosphate ABC transporter permease UgpA -
H1D09_RS18370 3803614..3804459 + 846 WP_000572183.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
H1D09_RS18375 3804461..3805531 + 1071 WP_000907824.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3797667..3806271 8604


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13975.23 Da        Isoelectric Point: 6.4830

>T289296 WP_175058671.1 NZ_LR778152:3800729-3801106 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNSLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT289296 WP_000557315.1 NZ_LR778152:3800511-3800732 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References